Sequence 1: | NP_648688.2 | Gene: | Neurl4 / 39558 | FlyBaseID: | FBgn0283503 | Length: | 1780 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001076443.1 | Gene: | Neurl2 / 415115 | MGIID: | 3043305 | Length: | 285 | Species: | Mus musculus |
Alignment Length: | 263 | Identity: | 58/263 - (22%) |
---|---|---|---|
Similarity: | 97/263 - (36%) | Gaps: | 76/263 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 654 PLRFHSIHGANAGISNSGLTASRPNSLAEFNDAIVFSNRPLRQRELFEVELETMVRHWSGNIEIG 718
Fly 719 VTGTRPEDIQLAPNATDLEASDTIILCGPMIF-----HNR------------------------- 753
Fly 754 ------KTIRTNI---------------LLDLDTLGPS---TRVGVM----RNGDF-IHFFVDGM 789
Fly 790 DQGPACE--CHAPNIWAIIDLYGQCAQVSLTQTQLDIRAPYATSENSQSCQAT---SVIQHPAME 849
Fly 850 TKH 852 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Neurl4 | NP_648688.2 | NEUZ | 5..126 | CDD:128856 | |
SPRY_NHR_like | 8..168 | CDD:293945 | |||
NEUZ | 221..345 | CDD:128856 | |||
SPRY_NHR_like | 225..387 | CDD:293945 | |||
NEUZ | 464..587 | CDD:128856 | |||
SPRY_NHR_like | 467..629 | CDD:293945 | |||
NEUZ | 653..777 | CDD:128856 | 41/180 (23%) | ||
SPRY_NHR_like | 656..818 | CDD:293945 | 50/222 (23%) | ||
SPRY_NHR_like | 854..1016 | CDD:293945 | |||
SPRY_NHR_like | 1063..1220 | CDD:293945 | |||
Neurl2 | NP_001076443.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..28 | 3/4 (75%) | |
SPRY_NHR_like | 25..242 | CDD:293945 | 50/222 (23%) | ||
SOCS_box | 249..285 | CDD:198037 | 4/25 (16%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |