DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neurl4 and CG3894

DIOPT Version :9

Sequence 1:NP_648688.2 Gene:Neurl4 / 39558 FlyBaseID:FBgn0283503 Length:1780 Species:Drosophila melanogaster
Sequence 2:NP_611963.5 Gene:CG3894 / 37959 FlyBaseID:FBgn0035059 Length:322 Species:Drosophila melanogaster


Alignment Length:296 Identity:73/296 - (24%)
Similarity:109/296 - (36%) Gaps:103/296 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   604 PAANNVPERVYGVIDLYGQAAQ-------------ASIVDTSECGSPDTGNSTISNTTLYSEVPL 655
            |||...|.|.     .|..|.|             .|.:.:.||.      .|:|:......   
  Fly    13 PAALCAPSRA-----AYAAAEQEDPDPDQEQDRGRESPIGSLECA------PTLSSRKRQLS--- 63

  Fly   656 RFHSIHGANAGISNSGLTASRPNSLAEFNDAIVFSNRPLRQRELFEVELETMVRHWSGNIEIGVT 720
            |||..||:|..:.:....|.|   .|.|.||:.||.|||...::|.||:|.:.|.|||::.:|:|
  Fly    64 RFHPYHGSNIQLGDDATVAYR---RASFADALTFSERPLAPGDIFLVEIEKIERGWSGHMRLGLT 125

  Fly   721 GTRPEDIQLAPNA--TDLEA------SDTIILCGPMI-----FHNRKTIRTNILLDLDT------ 766
                   :||||.  |..|.      .|...|....|     |...:....|.:::.:|      
  Fly   126 -------ELAPNVIRTSSEGLPHFALPDLANLGNSWIYPISKFEMNQRQDANDIIEPETDDAPHR 183

  Fly   767 --LGPSTRV-------------GVMRNGD---------------------------FIHFFVDGM 789
              ||.:|.|             ..|.||:                           .:||.::|:
  Fly   184 NLLGDATHVRTPRGLLPKRLLRPAMGNGNDSDILLTDKGSRIGIIYVPTVQSDSKGELHFIINGV 248

  Fly   790 DQGPACE----CHAPNIWAIIDLYGQCAQVSLTQTQ 821
            |:||...    ..|| ::.:||:||...|:.:.|.:
  Fly   249 DRGPVSRDIPLNRAP-LFVVIDVYGTTKQIRIIQLE 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neurl4NP_648688.2 NEUZ 5..126 CDD:128856
SPRY_NHR_like 8..168 CDD:293945
NEUZ 221..345 CDD:128856
SPRY_NHR_like 225..387 CDD:293945
NEUZ 464..587 CDD:128856
SPRY_NHR_like 467..629 CDD:293945 9/37 (24%)
NEUZ 653..777 CDD:128856 43/157 (27%)
SPRY_NHR_like 656..818 CDD:293945 59/226 (26%)
SPRY_NHR_like 854..1016 CDD:293945
SPRY_NHR_like 1063..1220 CDD:293945
CG3894NP_611963.5 SPRY_NHR_like 64..280 CDD:293945 59/226 (26%)
SOCS_SOCS_like 283..321 CDD:239687 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D491552at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12429
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.