DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neurl4 and neurl2

DIOPT Version :9

Sequence 1:NP_648688.2 Gene:Neurl4 / 39558 FlyBaseID:FBgn0283503 Length:1780 Species:Drosophila melanogaster
Sequence 2:XP_002932555.2 Gene:neurl2 / 100494896 XenbaseID:XB-GENE-1010743 Length:274 Species:Xenopus tropicalis


Alignment Length:268 Identity:63/268 - (23%)
Similarity:109/268 - (40%) Gaps:72/268 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   450 SETISSTRAIARNDDRLTFHHICGTHATVTQSGRTALRPNAADDFNNGVVLTRRPLRPNELFQVR 514
            :|..:.|.|: :....::||||.|.:..:..||..|.|   .:.|.||:..::.||:|.::|.|.
 Frog     3 AEIFTGTMAV-QCQPFMSFHHIHGANVRIDPSGTLATR---VESFANGICFSQEPLQPGQIFLVE 63

  Fly   515 LERVVTKWAGSVEMGVTTHSADELDF--PFTMTNV--RSGTWM--MTGNGVMQNGVTVIE----- 568
            :|.....|.|.:.:|:.......||.  .:::.::  ..|:|:  :|.|   .|.|...|     
 Frog    64 IEDKELGWCGHLRVGLMARDPHNLDVVPEYSLPDLVNEGGSWIFAITRN---HNKVQTEEDSNTI 125

  Fly   569 ------------------------------QYGQNLDRL---------QVGDRVGVV--RKDDGT 592
                                          ::...||.|         .:..|:||:  .:.|||
 Frog   126 AIKGLLADPYLKVGKFKYPREKLVARSRPGRFSHILDELYKSNVLPPTALRSRIGVLYEPQSDGT 190

  Fly   593 --LHFWVNGVDQGPAANNVP--ERVYGVIDLYGQAAQASIVDTSECGSPDTGNSTISNTTLYSEV 653
              :|..:||.|.||:|..:|  |.:|.|||::.......::.. |.|.|       |..|| ..:
 Frog   191 RNMHIIINGEDMGPSAKGIPATEPLYAVIDVFASTKSVRVIQL-EYGFP-------SLQTL-CRL 246

  Fly   654 PLRFHSIH 661
            .::.|.:|
 Frog   247 VIQKHIVH 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neurl4NP_648688.2 NEUZ 5..126 CDD:128856
SPRY_NHR_like 8..168 CDD:293945
NEUZ 221..345 CDD:128856
SPRY_NHR_like 225..387 CDD:293945
NEUZ 464..587 CDD:128856 36/174 (21%)
SPRY_NHR_like 467..629 CDD:293945 52/217 (24%)
NEUZ 653..777 CDD:128856 2/9 (22%)
SPRY_NHR_like 656..818 CDD:293945 2/6 (33%)
SPRY_NHR_like 854..1016 CDD:293945
SPRY_NHR_like 1063..1220 CDD:293945
neurl2XP_002932555.2 SPRY_NHR_like 19..231 CDD:293945 52/217 (24%)
SOCS_box 238..274 CDD:198037 6/25 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D491552at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.