DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsc70Cb and Ankrd45

DIOPT Version :9

Sequence 1:NP_001189103.1 Gene:Hsc70Cb / 39557 FlyBaseID:FBgn0026418 Length:836 Species:Drosophila melanogaster
Sequence 2:XP_030099044.2 Gene:Ankrd45 / 73844 MGIID:1921094 Length:313 Species:Mus musculus


Alignment Length:281 Identity:56/281 - (19%)
Similarity:91/281 - (32%) Gaps:106/281 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 MKNTVGGFKRLLGRKFNDP-HVQHELTSIPARVEARGDGSIGIKVNYLGEDQHFGPEQLTAMLFT 123
            ::.|:.|....|.:.|.|| |..||..                 |..|.|:...|...|.|    
Mouse   100 LQPTLTGDVEGLQKIFEDPEHPHHEHA-----------------VQLLLEEDIVGRNLLYA---- 143

  Fly   124 KLKETSAAAMQTQVNDCVIACPVFFTNAERKALLDAAQIAGLNVLRLMNETTATALAYGFYKNDL 188
                               ||     .|.:..::.|....|:|    :||.||.           
Mouse   144 -------------------AC-----MAGKSDVIKALAKYGVN----LNEATAR----------- 169

  Fly   189 FEDKPRNVIFVDFGHSSLQASACAFTKGKLKMLASTWDQIGGRDIDLALGDY---FAKEFQERYK 250
                         |::.|.   ||...|:|:.|.:..:    .|:|:...::   .|::...||.
Mouse   170 -------------GYTLLH---CAAAWGRLETLKALVE----LDVDIEALNFRGEKARDVAARYS 214

  Fly   251 ----INAKTNARANLRL----------LTEIEK-----LKKQMSANSTKLPLNIECFLDDIDVSS 296
                :|....|.|.|.|          :|:.||     .|:..|.......|..|......:.|.
Mouse   215 QVECVNFLDWADARLILKKIITKSSLIITDPEKGPGKLFKEDKSTILNACRLKNEWLESHPEASI 279

  Fly   297 S---MQRSQMEELCAPVLQRV 314
            |   .|:.|:|::.:|:|.::
Mouse   280 SEIFEQKQQLEDIVSPILAKM 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsc70CbNP_001189103.1 HSPA4_like_NDB 2..381 CDD:212670 56/281 (20%)
HSP70 3..682 CDD:278441 56/281 (20%)
Ankrd45XP_030099044.2 Ank_2 123..200 CDD:403870 27/156 (17%)
ANK repeat 137..167 CDD:293786 11/61 (18%)
ANK repeat 169..200 CDD:293786 9/61 (15%)
PTZ00009 <246..300 CDD:240227 13/53 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.