DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsc70Cb and ankrd45

DIOPT Version :9

Sequence 1:NP_001189103.1 Gene:Hsc70Cb / 39557 FlyBaseID:FBgn0026418 Length:836 Species:Drosophila melanogaster
Sequence 2:NP_001018606.1 Gene:ankrd45 / 553808 ZFINID:ZDB-GENE-050522-311 Length:224 Species:Danio rerio


Alignment Length:252 Identity:55/252 - (21%)
Similarity:81/252 - (32%) Gaps:93/252 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 AESKLQL-----DDIHSVEIVGGSSRIPSVKQLIEQVFNKPASTTLN---QDEAVSRGAALQCAI 379
            ||.|..|     ||:.            .:|.::|:.|...|:.:.|   :.:.|.|.|.....:
Zfish     4 AEEKTVLLCALDDDLE------------GLKGILERTFTDDAAQSENILWEKDEVGRNALFAACM 56

  Fly   380 MSPAVRVREFGVTDIQNYAVKVLWDSEGSAAPGEIEIFPQYHASPFSRLLTINRKGPFNVSIVYG 444
            |..:..|||.    :||          |:|...|               ||.....|.:.|.::|
Zfish    57 MGRSAIVREL----VQN----------GAADVNE---------------LTARGYSPLHCSAMWG 92

  Fly   445 QQVPYPDQTIGVWKVKDVKPTERGEGQDVKLKVRINNNGIVLISSATLVEKKEAEEAAAAAE--- 506
            |              .|...|......|.:   .||..|...:..|...:|.:..|..|.||   
Zfish    93 Q--------------LDTLKTLVELNADFQ---AINFRGEKAVDVARRYDKLDCAEYLAWAEAKQ 140

  Fly   507 --QA---------ASEEKPGDQTNNTGEPADGQQEAYCEN------EDDNNTSTASS 546
              ||         |.:||...:.|.       :.:..|.|      |..|||.||::
Zfish   141 NLQAFIQEVRAIVADQEKVQGKLNK-------EDKNICINTCSAKSEWINNTRTATA 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsc70CbNP_001189103.1 HSPA4_like_NDB 2..381 CDD:212670 14/65 (22%)
HSP70 3..682 CDD:278441 55/252 (22%)
ankrd45NP_001018606.1 ANK <42..133 CDD:238125 27/136 (20%)
ANK repeat 46..78 CDD:293786 12/60 (20%)
Ank_2 51..143 CDD:289560 27/137 (20%)
ANK repeat 80..111 CDD:293786 7/47 (15%)
ANK repeat 113..143 CDD:293786 7/29 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.