DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsc70Cb and SLC9C2

DIOPT Version :9

Sequence 1:NP_001189103.1 Gene:Hsc70Cb / 39557 FlyBaseID:FBgn0026418 Length:836 Species:Drosophila melanogaster
Sequence 2:XP_011507728.1 Gene:SLC9C2 / 284525 HGNCID:28664 Length:1129 Species:Homo sapiens


Alignment Length:249 Identity:51/249 - (20%)
Similarity:83/249 - (33%) Gaps:71/249 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 MSANSTKLPLNIECFLDDIDVSSSMQRSQMEELCAPVLQRVEQTFKRLLAESKLQLDDIHSVEIV 338
            |:.::.||.|   |.|       |:.|..:.:.....:|.:.|....|....|: |.:::.. :|
Human   425 MTQSARKLDL---CVL-------SLPRQMILQNATQHIQEIVQNTITLFKTEKI-LTNVNWT-LV 477

  Fly   339 GGSSRIPSVKQLIEQVFNKPASTTLNQDEAVSRGAALQCAI--MSPAVRVREFGVTDIQNY---- 397
            ...:||..:.  ...|.:....|....|||:...|.|..|.  ||...:.|..|:.:|:..    
Human   478 EDKTRIEYIP--FSHVSHNDMKTESTTDEALMEEARLHVAAIQMSSFEKQRNNGILEIEAARILI 540

  Fly   398 -AVKVLWDSEGSAAPGEIEIFPQYHASPFSR----------LLTI---------------NRKGP 436
             |.|..:..:|       :....|..|.:.|          :||.               |....
Human   541 GAAKCYYSIQG-------KFMSIYDVSTYMRTRSWLIKFKNVLTFLEYCIEKIHFIPPESNTFLT 598

  Fly   437 FNVSIVYGQQVPYPDQTIG----------VWKVKDVKPTERGEGQDVKLKVRIN 480
            |...||:.::..|..|.|.          :|      |..|  |.:|...:.||
Human   599 FIFHIVFSEEFEYTGQIINLIYIYPMIIHLW------PMAR--GLNVSALISIN 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsc70CbNP_001189103.1 HSPA4_like_NDB 2..381 CDD:212670 24/108 (22%)
HSP70 3..682 CDD:278441 51/249 (20%)
SLC9C2XP_011507728.1 Na_H_Exchanger 98..380 CDD:294713
Ion_trans 638..>731 CDD:278921 2/7 (29%)
CAP_ED 873..980 CDD:237999
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.