DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6661 and ALDH8A1

DIOPT Version :9

Sequence 1:NP_648686.3 Gene:CG6661 / 39556 FlyBaseID:FBgn0036403 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_072090.1 Gene:ALDH8A1 / 64577 HGNCID:15471 Length:487 Species:Homo sapiens


Alignment Length:488 Identity:115/488 - (23%)
Similarity:201/488 - (41%) Gaps:89/488 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 YTMDTQRVCCPHHLQTNLAHVYYANRKQIEAAIKSALSAQGTWSLVPIAQRLAIWRRAATIIEED 159
            |...|..|.|         .|..:.:.:||||:|:|..|..:||.....:|..:..:.|.::|:.
Human    28 YDPSTGEVYC---------RVPNSGKDEIEAAVKAAREAFPSWSSRSPQERSRVLNQVADLLEQS 83

  Fly   160 ELRLRVFLMMTLSKTADDA-------TRDIRRLLTSLRANA-DYLEHLSE-LRFEIQGDMNVFPS 215
               |..|..   :::.|..       |.||.|.:.:.|..| ..|.|.|| .:.:..|.|:    
Human    84 ---LEEFAQ---AESKDQGKTLALARTMDIPRSVQNFRFFASSSLHHTSECTQMDHLGCMH---- 138

  Fly   216 FHLRPMDGFVAALAPFESVALSSSLALCPAL-MGNTVLWNPSLEVAPVSYLIFRAFQEAGLPSGV 279
            :.:|...|....::|:.......:..:.||: .||||:..||...:..::::.:...:||:|.||
Human   139 YTVRAPVGVAGLISPWNLPLYLLTWKIAPAMAAGNTVIAKPSELTSVTAWMLCKLLDKAGVPPGV 203

  Fly   280 INFV-----PANERLFLDTITDAVHFAGLN------TQASAAFYRHVHKLVSDRMERYICFPRLV 333
            :|.|     ...|.|........:.|.|..      ||.||.   |..|              |.
Human   204 VNIVFGTGPRVGEALVSHPEVPLISFTGSQPTAERITQLSAP---HCKK--------------LS 251

  Fly   334 AECPGQNFHFVHASAKVESVVSATVQAAFGFAGQYANSLSRMYVPSSMWPRLREELVEATEQLTI 398
            .|..|:|...:...|.::..:.|||:::|...|:.....||::|..|::....:..||||.:..:
Human   252 LELGGKNPAIIFEDANLDECIPATVRSSFANQGEICLCTSRIFVQKSIYSEFLKRFVEATRKWKV 316

  Fly   399 GDPIESETDIGAMVHINDFRRMQKLLQR--TKNMEQLCGGSCD-------DSTGRFVDPTIVRVS 454
            |.|.:....|||::......:::..::|  .:..:..||...|       :..|.|:.||:  ::
Human   317 GIPSDPLVSIGALISKAHLEKVRSYVKRALAEGAQIWCGEGVDKLSLPARNQAGYFMLPTV--IT 379

  Fly   455 DPLDPLLCEPCC------GPFLPVFVYSDDSFSEALKLAANQSRYALSGSIFASQDEVILHCLNQ 513
            |..|    |.||      ||...|..:  ||..|.:: .||..:|.|:.::::|....:.....:
Human   380 DIKD----ESCCMTEEIFGPVTCVVPF--DSEEEVIE-RANNVKYGLAATVWSSNVGRVHRVAKK 437

  Fly   514 LRMSA--SNLYVNERCTGSTYGLTPFGGNRLSG 544
            |:...  :|.::.....      .||||.:.||
Human   438 LQSGLVWTNCWLIRELN------LPFGGMKSSG 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6661NP_648686.3 ALDH-SF 68..567 CDD:299846 115/488 (24%)
ALDH8A1NP_072090.1 ALDH_F8_HMSADH 27..485 CDD:143412 115/488 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.