DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6661 and Aldh9a1

DIOPT Version :9

Sequence 1:NP_648686.3 Gene:CG6661 / 39556 FlyBaseID:FBgn0036403 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_071609.2 Gene:Aldh9a1 / 64040 RGDID:68409 Length:497 Species:Rattus norvegicus


Alignment Length:466 Identity:112/466 - (24%)
Similarity:207/466 - (44%) Gaps:74/466 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 ANRKQIEAAIKSALSAQGTWSLVPIAQRLAIWRRAATIIEE--DELRLRVFLMMTLS--KTADDA 178
            :..|::..|:::|.:|...||.....:|..:...||.||:|  ||    :.:|.|::  |:..:|
  Rat    46 SGEKEVNLAVENAKAAFKIWSKKSGLERCQVLLEAARIIKERRDE----IAIMETINNGKSIFEA 106

  Fly   179 TRDIRRLLTSLRANADYLEHLSELRFEIQGDMNVFP--SF---HLRPMD---GFVAALAPFESVA 235
            ..|:.   ||.:.    ||:.:.|...:.|:....|  ||   ...|:.   |..|...||:...
  Rat   107 RLDVD---TSWQC----LEYYAGLAASMAGEHIQLPGGSFGYTRREPLGVCLGIGAWNYPFQIAC 164

  Fly   236 LSSSLALCPALMGNTVLWNPSLEVAPVSYLIF-RAFQEAGLPSGVINFVP--ANERLFLDTITDA 297
            ..|:.||.   .||.:::.|| ...|||.|:. ..:.:||.|:|:.|.|.  |....||....|.
  Rat   165 WKSAPALA---CGNAMIFKPS-PFTPVSALLLAEIYTKAGAPNGLFNVVQGGAATGQFLCQHRDV 225

  Fly   298 --VHFAGLNTQASAAFYRHVHKLVSDRMERYICFPRLVAECPGQNFHFVHASAKVESVVSATVQA 360
              |.|.|     |......:.::.:..::      .:..|..|::...:.:...:::.|...:.|
  Rat   226 AKVSFTG-----SVPTGMKIMEMAAKGIK------PITLELGGKSPLIIFSDCNMKNAVKGALLA 279

  Fly   361 AFGFAGQYANSLSRMYVPSSMWPRLREELVEATEQLTIGDPIESETDIGAMVHINDFRRMQKLLQ 425
            .|...||...:.:|::|...:.....:|:|..|:::.||||:..:|.:|.:::.....|:...::
  Rat   280 NFLTQGQVCCNGTRVFVQKEIADAFTKEVVRQTQRIKIGDPLLEDTRMGPLINAPHLERVLGFVR 344

  Fly   426 RTKNMEQ----LCGG---SCDD---STGRFVDPTIVRVSDPLDPLLC--EPCCGPFLPVFVYSDD 478
            ..|  ||    ||||   :.:|   ..|.::.|.|  :::..|.:.|  |...||.:.:..:..:
  Rat   345 SAK--EQGATVLCGGEPYAPEDPKLKHGYYMTPCI--LTNCTDDMTCVKEEIFGPVMSILTFETE 405

  Fly   479 SFSEALKLAANQSRYALSGSIFASQDEVILHCLNQLRMSASNLYVNERCTGSTYGLT----PFGG 539
              :|.|: .||.:.:.|:..:| ::|....|.: ...:.|...|:|      .|.::    ||||
  Rat   406 --AEVLE-RANDTTFGLAAGVF-TRDIQRAHRV-AAELQAGTCYIN------NYNVSPVELPFGG 459

  Fly   540 NRLSGTNDKSG 550
            .:.||...::|
  Rat   460 YKKSGFGRENG 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6661NP_648686.3 ALDH-SF 68..567 CDD:299846 112/466 (24%)
Aldh9a1NP_071609.2 ALDH_F9_TMBADH 31..488 CDD:143409 112/466 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.