DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6661 and CG12516

DIOPT Version :9

Sequence 1:NP_648686.3 Gene:CG6661 / 39556 FlyBaseID:FBgn0036403 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_651615.2 Gene:CG12516 / 43370 FlyBaseID:FBgn0039577 Length:300 Species:Drosophila melanogaster


Alignment Length:303 Identity:56/303 - (18%)
Similarity:107/303 - (35%) Gaps:111/303 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QKAVQP-------EQDEDQQEVEPDSQPAEENPSIHRNQRVLVNHAIQEIQHRPLE--------V 85
            :.|::|       |:..::.|||.:::.:|   ::..:::.::     |:...|.|        .
  Fly    29 EDAIKPPTEDINFEEKSNENEVEDNTEKSE---AVSESEKEVI-----EVSEEPKEEEVKYAWNA 85

  Fly    86 PTIIGDDTVYTMDTQRVCCPHHLQTNLAH-----------VYYANRKQIEAAIKSALSAQGTWSL 139
            |.::    |...|....|..|||..:|..           |..|..::||..:|..:.       
  Fly    86 PCMM----VIFEDGDVNCALHHLVESLQDPFALDAVAVILVQEALAEEIENRVKILMK------- 139

  Fly   140 VPIAQRLA---IWRRAATIIEEDELRLRVFLMMTLSKTADDAT----RDI-RRLL---------- 186
             |:..|:|   .::|  |:::.||||.:..:..: .:...|||    ||| .:.|          
  Fly   140 -PLDARVANHPCYKR--TLMKIDELRPKTIIGPS-DRVLPDATPIMVRDIPHKFLGDGPTGIITM 200

  Fly   187 ----TSLRANADYL--------------EHLSELRFEIQGDMNVFPSFHLRPMDGFVAALAPFES 233
                |...|...|.              |.:|.: :::.|.||:..:|.:   :.|...:.|.:.
  Fly   201 HIFRTPFEATQIYRKEYPLPIASVSIWNERVSSV-YDVIGMMNLLDTFKI---NCFTVDMEPIKR 261

  Fly   234 VALSSSLALCPALMGNTVLWNPSLEVAPVSYLIFRAFQEAGLP 276
                                  :.|:...|..|.|.:....||
  Fly   262 ----------------------AFELRKYSACIHRGYHYETLP 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6661NP_648686.3 ALDH-SF 68..567 CDD:299846 49/264 (19%)
CG12516NP_651615.2 DUF1487 82..298 CDD:254173 46/242 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.