DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6661 and Ssadh

DIOPT Version :9

Sequence 1:NP_648686.3 Gene:CG6661 / 39556 FlyBaseID:FBgn0036403 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001014665.1 Gene:Ssadh / 43092 FlyBaseID:FBgn0039349 Length:509 Species:Drosophila melanogaster


Alignment Length:451 Identity:105/451 - (23%)
Similarity:189/451 - (41%) Gaps:47/451 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 RKQIEAAIKSALSAQGTWSLVPIAQRLAIWRRAATIIEEDELRLRVFLMMTLSKTADDATRDIRR 184
            :|.|:|| |.|..:: .|..:....|..:.::...:||:....:...:.....|..:::..::  
  Fly    70 QKAIDAA-KQAYESK-EWRSLTAKDRSNLLKKWHKLIEQHSQEIAEIMTAESGKPINESKGEV-- 130

  Fly   185 LLTSLRANADYLEHLSELRFEIQGDMNVFPS-------FHLRPMDGFVAALAPFE-SVALSSSLA 241
                ...|| ::|..:|....|.|:  :.||       ..::...|..|.:.|:. .:|:.:..|
  Fly   131 ----AYGNA-FVEWFAEEARRIYGE--IVPSASPNREIIVMKQPIGVAALITPWNFPMAMITRKA 188

  Fly   242 LCPALMGNTVLWNPSLEVAPVSYLIFRAFQEAGLPSGVINFVPANERLFLDTI------TDAVHF 300
            ......|.||:..||.:....:..:.:...:||:|.||||.|..|:...:..:      ...:.|
  Fly   189 GAALAAGCTVVVKPSEDTPLTALAVAKLAVDAGIPKGVINVVTTNKAAPIGDLFCKSPDVRGISF 253

  Fly   301 AGLNTQASAAFYRHVHKLVSDRMERYICFPRLVAECPGQNFHFVHASAKVESVVSATVQAAFGFA 365
            .| :|:.....:|:    .:|.::| ||.     |..|.....|..||.:|..|...:.:.|...
  Fly   254 TG-STEVGKLLFRN----SADGIKR-ICL-----ELGGNAPFIVFDSADIEKAVDGAMASKFRNC 307

  Fly   366 GQYANSLSRMYVPSSMWPRLREELVEATEQLTIGDPIESETDIGAMVHINDFRRMQKLLQ--RTK 428
            ||...|.:|.:|..|::.:...:|.:..|.|.|||....:..||.:::...|.::...::  |:|
  Fly   308 GQTCVSANRFFVQDSVYDKFVGQLKKRVEALKIGDGQGCDVQIGPLINEMQFNKVSGFVEDARSK 372

  Fly   429 NMEQLCGGS-CDDSTGRFVDPTIVRVSDPLDPLLCEPCCGPFLPVFVYSDDSFSEALKLAANQSR 492
            ....:.||. ..|....|..||||....|...|..|...||.:.:..:.|:  .||:| .||.:|
  Fly   373 KANIILGGQPLPDKGSLFYAPTIVTDVPPSAQLYSEEVFGPVVSIIRFRDE--EEAVK-KANDTR 434

  Fly   493 YALSGSIFASQDEVILHCLNQLRMSASNLYVNERCTGSTYGLTPFGGNRLSGTNDKSGSAY 553
            ..|:|..::...:.:.....  |:....:.|||....:..  .||||.:.||.. :.||.:
  Fly   435 RGLAGYFYSENLQQVFRVAK--RLEVGMVGVNEGIISAAE--APFGGVKESGVG-REGSKH 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6661NP_648686.3 ALDH-SF 68..567 CDD:299846 105/451 (23%)
SsadhNP_001014665.1 ALDH_F5_SSADH_GabD 49..503 CDD:143421 105/451 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454114
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.