DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6661 and Aldh7a1

DIOPT Version :9

Sequence 1:NP_648686.3 Gene:CG6661 / 39556 FlyBaseID:FBgn0036403 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001258034.1 Gene:Aldh7a1 / 291450 RGDID:1308614 Length:539 Species:Rattus norvegicus


Alignment Length:482 Identity:114/482 - (23%)
Similarity:198/482 - (41%) Gaps:75/482 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 CPHHLQTNLAHVYYANRKQIEAAIKSALSAQGTWSLVPIAQRLAIWRRAATIIEEDELRLRVFLM 168
            ||.:.:. :|.|..|:.|..|..|..|..|...|:.:|..:|..|.|:....:.|....|...:.
  Rat    70 CPANNEP-IARVRQASMKDYEETIGKAKKAWNIWADIPAPKRGEIVRKIGDALREKIQLLGRLVS 133

  Fly   169 MTLSKTADDATRDIRRLLTSLRANADYLEHLSELRFEIQGDMNVFPSFHLRP----MD-----GF 224
            :.:.|...:...:::..:..    .||...||.:   |.|.  ..||  .||    |:     |.
  Rat   134 LEMGKILVEGIGEVQEYVDV----CDYAAGLSRM---IGGP--TLPS--ERPGHALMEQWNPLGL 187

  Fly   225 VAALAPFE-SVAL---SSSLALCPALMGNTVLW----NPSLEVAPVSYLIFRAFQEAGLPSGVIN 281
            |..:..|. .||:   ::::||   :.||..||    ..||....|:.:|.:..::..||..:.:
  Rat   188 VGIITAFNFPVAVFGWNNAIAL---ITGNVCLWKGAPTTSLVSIAVTKIIAKVLEDNLLPGAICS 249

  Fly   282 F----------VPANERLFLDTITDAVHFAGLNTQASAAFYRHVHKLVSDRMERYICFPRLVAEC 336
            .          :..:||:.|      :.|.| :||..    :.|..:|.:|      |.:.:.|.
  Rat   250 LTCGGADMGTAMARDERVNL------LSFTG-STQVG----KQVALMVQER------FGKSLLEL 297

  Fly   337 PGQNFHFVHASAKVESVVSATVQAAFGFAGQYANSLSRMYVPSSMWPRLREELVEATEQLTIGDP 401
            .|.|.......|.:..|:.:.:.||.|.|||...::.|:::..|:...:.:.|..|..|:.:|:|
  Rat   298 GGNNAIIAFEDADLSLVLPSALFAAVGTAGQRCTTVRRLFLHESIHDEVVDRLKNAYSQIRVGNP 362

  Fly   402 IESETDIGAMVHINDFRRMQKLLQRTKNMEQ-----LCGGSCDDSTGRFVDPTIVR--VSDPLDP 459
            .:.....|.: |..  :.:...:|..:..::     :.||...|..|.:|:||||.  |.|.  |
  Rat   363 WDPNILYGPL-HTK--QAVSMFVQAVEEAKKEGGTVVYGGKVMDHPGNYVEPTIVTGLVHDA--P 422

  Fly   460 LLCEPCCGPFLPVFVYSDDSFSEALKLAANQSRYALSGSIFASQDEVILHCLNQLRMSASNLYVN 524
            ::.:....|.|.||.:.::   |.:....|:.:..||.|||......|...|.........:.||
  Rat   423 IVHKETFAPILYVFKFKNE---EEVFEWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVN 484

  Fly   525 ERCTGSTYGLTPFGGNRLSGTNDKSGS 551
            ...:|:..| ..|||.:.:|...:|||
  Rat   485 IPTSGAEIG-GAFGGEKHTGGGRESGS 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6661NP_648686.3 ALDH-SF 68..567 CDD:299846 114/482 (24%)
Aldh7a1NP_001258034.1 ALDH_F7_AASADH 53..527 CDD:143448 114/482 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.