DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6661 and ALDH3B1

DIOPT Version :9

Sequence 1:NP_648686.3 Gene:CG6661 / 39556 FlyBaseID:FBgn0036403 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_000685.1 Gene:ALDH3B1 / 221 HGNCID:410 Length:468 Species:Homo sapiens


Alignment Length:451 Identity:100/451 - (22%)
Similarity:169/451 - (37%) Gaps:90/451 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 PIAQRLAIWRRAATIIEEDELRLRVFLMMTLSKTADD---------------ATRDIRRLLTSLR 190
            |...|.|..:.....::|::..|...|...|.|:|.:               |.|::|..:...|
Human    22 PAEFRAAQLQGLGRFLQENKQLLHDALAQDLHKSAFESEVSEVAISQGEVTLALRNLRAWMKDER 86

  Fly   191 ANADYLEHLSELRFEIQGDMNVFPSFHLRPMDGFVAALAPFESVALSSSLALCPAL----MGNTV 251
            ...:....|..             :|..:...|.|..:||:.   ...:|.|.|.:    .||.|
Human    87 VPKNLATQLDS-------------AFIRKEPFGLVLIIAPWN---YPLNLTLVPLVGALAAGNCV 135

  Fly   252 LWNPS----------LEVAPVSYLIFRAFQEAGLPSGVINFVPANERLFLDTITDAVHFAGLNTQ 306
            :..||          .||.| .|:....|       .|:...|......|:...|.:.|.|    
Human   136 VLKPSEISKNVEKILAEVLP-QYVDQSCF-------AVVLGGPQETGQLLEHRFDYIFFTG---- 188

  Fly   307 ASAAFYRHVHKLVSDRMERYICFPRLVAECPGQNFHFVHASAKVESVVSATVQAAFGFAGQYANS 371
                 ...|.|:|.....:::  ..:..|..|:|..:|..:...::|.:......:..|||  ..
Human   189 -----SPRVGKIVMTAAAKHL--TPVTLELGGKNPCYVDDNCDPQTVANRVAWFRYFNAGQ--TC 244

  Fly   372 LSRMYVPSSMWPRLREELVEATEQLTI----GDPIESETDIGAMVHINDFRRMQKLLQRTKNMEQ 432
            ::..||..|  |.::|.|:.|. |.||    ||..:|..::|.:::...|:|::.||.       
Human   245 VAPDYVLCS--PEMQERLLPAL-QSTITRFYGDDPQSSPNLGRIINQKQFQRLRALLG------- 299

  Fly   433 LCG----GSCDDSTGRFVDPTIVRVSDPLDPLLCEPCCGPFLPVFVYSDDSFSEALKLAANQSRY 493
             ||    |...|.:.|::.||::.....::|::.|...||.||  :.:..|..||::. .|:...
Human   300 -CGRVAIGGQSDESDRYIAPTVLVDVQEMEPVMQEEIFGPILP--IVNVQSLDEAIEF-INRREK 360

  Fly   494 ALSGSIFASQDEVILHCLNQLRMSASNLYVNERCTGSTYGLTPFGGNRLSGTNDKSGSAYF 554
            .|:...|::..:|:...|.|  .|:.....|:.....|....||||...||.....|...|
Human   361 PLALYAFSNSSQVVKRVLTQ--TSSGGFCGNDGFMHMTLASLPFGGVGASGMGRYHGKFSF 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6661NP_648686.3 ALDH-SF 68..567 CDD:299846 100/451 (22%)
ALDH3B1NP_000685.1 ALDH_F3AB 6..447 CDD:143450 100/451 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.