DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6661 and ALDH2

DIOPT Version :9

Sequence 1:NP_648686.3 Gene:CG6661 / 39556 FlyBaseID:FBgn0036403 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_000681.2 Gene:ALDH2 / 217 HGNCID:404 Length:517 Species:Homo sapiens


Alignment Length:549 Identity:127/549 - (23%)
Similarity:217/549 - (39%) Gaps:84/549 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PA-EENPSIHRNQRVLVNHAIQEIQHRPLEVPTIIGDDTVYTMDTQRVCCPHHLQTNLAHVYYAN 119
            || .:.|.:..|| :.:|:...:...|. ..||:       ...|..|.|         .|...:
Human    26 PAPNQQPEVFCNQ-IFINNEWHDAVSRK-TFPTV-------NPSTGEVIC---------QVAEGD 72

  Fly   120 RKQIEAAIKSALSA---QGTWSLVPIAQRLAIWRRAATIIEEDELRLRVFLMMTLSKTADDATR- 180
            ::.::.|:|:|.:|   ...|..:..:.|..:..|.|.:||.|...|...      :|.|:... 
Human    73 KEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLAAL------ETLDNGKPY 131

  Fly   181 ------DIRRLLTSLRANADYLEHLSELRFEIQGDMNVFPSFHLRPMDGFVAALAPFESVALSSS 239
                  |:..:|..||..|.:.:........|.||   |.|:......|....:.|:....|..:
Human   132 VISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGD---FFSYTRHEPVGVCGQIIPWNFPLLMQA 193

  Fly   240 LALCPAL-MGNTVLWNPSLEVAPVSYLIFRAFQEAGLPSGVINFVPANERLFLDTITDAVHFAGL 303
            ..|.||| .||.|:...:.:....:..:....:|||.|.||:|.||                 |.
Human   194 WKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVP-----------------GF 241

  Fly   304 NTQASAAFYRH--VHKLV---SDRMERYI-------CFPRLVAECPGQNFHFVHASAKVESVVSA 356
            ...|.||...|  |.|:.   |..:.|.|       ...|:..|..|::.:.:.:.|.::..|..
Human   242 GPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNLKRVTLELGGKSPNIIMSDADMDWAVEQ 306

  Fly   357 TVQAAFGFAGQYANSLSRMYVPSSMWPRLREELVEATEQLTIGDPIESETDIGAMVHINDFRRMQ 421
            ...|.|...||...:.||.:|...::....|..|...:...:|:|.:|:|:.|..|....|:::.
Human   307 AHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGPQVDETQFKKIL 371

  Fly   422 KLLQ--RTKNMEQLCGGSCDDSTGRFVDPTIV-RVSDPLDPLLCEPCCGPFLPVFVYSDDSFSEA 483
            ..:.  :.:..:.||||......|.|:.||:. .|.|.: .:..|...||.:.:..:..   .|.
Human   372 GYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGM-TIAKEEIFGPVMQILKFKT---IEE 432

  Fly   484 LKLAANQSRYALSGSIFASQDEVILHCLNQLRMSASNLYVNERCTGSTYGLTPFGGNRLSGTNDK 548
            :...||.|.|.|:.::| ::|....:.|:| .:.|..::||  |.......:||||.::||:..:
Human   433 VVGRANNSTYGLAAAVF-TKDLDKANYLSQ-ALQAGTVWVN--CYDVFGAQSPFGGYKMSGSGRE 493

  Fly   549 SGSAYFLMRWSSPLLIEETVDGPPPMRGS 577
            .|. |.|..::.    .:||....|.:.|
Human   494 LGE-YGLQAYTE----VKTVTVKVPQKNS 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6661NP_648686.3 ALDH-SF 68..567 CDD:299846 118/524 (23%)
ALDH2NP_000681.2 ALDH_F1AB_F2_RALDH1 31..511 CDD:143459 123/536 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.