DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6661 and ALDH1L2

DIOPT Version :9

Sequence 1:NP_648686.3 Gene:CG6661 / 39556 FlyBaseID:FBgn0036403 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001029345.2 Gene:ALDH1L2 / 160428 HGNCID:26777 Length:923 Species:Homo sapiens


Alignment Length:571 Identity:124/571 - (21%)
Similarity:224/571 - (39%) Gaps:100/571 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RRLGGMAI----IKGETKISVDKQKAVQPEQDEDQQEVEPDSQPAEENPSIHRNQRVLVNHAIQE 77
            ::.||:.:    :...||.....||.|:..:.|| ||||                 ::|::..:|
Human   387 QKCGGLQLQNEDVYMATKFEGFIQKVVRKLRGED-QEVE-----------------LVVDYISKE 433

  Fly    78 IQHRPLEVP---------TIIGD----DTVYTMDTQRVCCPHHLQTNLAHVYYANRKQIEAAIKS 129
            :....:::|         |...|    ||:...|...:|          .|.||:...::.|:.:
Human   434 VNEIMVKMPYQCFINGQFTDADDGKTYDTINPTDGSTIC----------KVSYASLADVDKAVAA 488

  Fly   130 ALSA--QGTWSLVPIAQRLAIWRRAATIIEEDELRLRVFLMMTLSKTADDATRDIRRLLTSLRAN 192
            |..|  .|.|..:...:|..:..|.|.::||::..|...      :..|........|.|.:..:
Human   489 AKDAFENGEWGRMNARERGRLMYRLADLLEENQEELATI------EALDSGAVYTLALKTHIGMS 547

  Fly   193 ADYLEHLSELRFEIQGDMNVFPSFHLRPMD----------GFVAALAP--FESVALSSSLALCPA 245
            .....:.:....:|||  :..|....||..          |..|.:.|  :..:.|:...|.|.|
Human   548 VQTFRYFAGWCDKIQG--STIPINQARPNRNLTFTKKEPLGVCAIIIPWNYPLMMLAWKSAACLA 610

  Fly   246 LMGNTVLWNPSLEVAPVSYLIFRAFQ-EAGLPSGVINFVPANERLFLDTITDAVHFAGLNTQASA 309
             .|||::..|: :|.|::.|.|.... :||.|.||||.:|.:..:....:::......|....|.
Human   611 -AGNTLVLKPA-QVTPLTALKFAELSVKAGFPKGVINIIPGSGGIAGQRLSEHPDIRKLGFTGST 673

  Fly   310 AFYRHVHK--LVSDRMERYICFPRLVAECPGQNFHFVHASAKVESVVSATVQAAFGFAGQYANSL 372
            ...:.:.|  .||:       ..::..|..|::...:....:::..|...:.|.|...|:...:.
Human   674 PIGKQIMKSCAVSN-------LKKVSLELGGKSPLIIFNDCELDKAVRMGMGAVFFNKGENCIAA 731

  Fly   373 SRMYVPSSMWPRLREELVEATEQLTIGDPIESETDIGAMVHINDFRRMQKLLQR-----TKNMEQ 432
            .|::|..|:.......:||..:::.||||::..||.|..   |....::||||.     .:....
Human   732 GRLFVEESIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQ---NHKAHLEKLLQYCETGVKEGATL 793

  Fly   433 LCGGSCDDSTGRFVDPTIVRVSDPLDPLLCEPCCGPFLPVFVYSDDSFSEALKLAANQSRYALSG 497
            :.||......|.|::||:....:....|..|...||.:.:..:.:......|: .||.:.|.|:.
Human   794 VYGGRQVQRPGFFMEPTVFTDVEDYMYLAKEESFGPIMVISKFQNGDIDGVLQ-RANSTEYGLAS 857

  Fly   498 SIFASQDEVILHCLNQLRMSASNLYVNERCTGSTYGLT----PFGGNRLSG 544
            .:|.......::...:|  .|..:::|      ||..|    ||||.:.||
Human   858 GVFTRDINKAMYVSEKL--EAGTVFIN------TYNKTDVAAPFGGVKQSG 900

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6661NP_648686.3 ALDH-SF 68..567 CDD:299846 111/516 (22%)
ALDH1L2NP_001029345.2 Fmt 22..326 CDD:223301
FMT_core_FDH_N 23..225 CDD:187716
GART 23..225
FDH_Hydrolase_C 228..327 CDD:187731
PP-binding 346..>390 CDD:278949 0/2 (0%)
Aldehyde dehydrogenase 438..923 109/502 (22%)
ALDH_F1L_FTFDH 439..923 CDD:143458 109/501 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.