DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment endos and AT4G16146

DIOPT Version :9

Sequence 1:NP_001246745.1 Gene:endos / 39554 FlyBaseID:FBgn0061515 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_567486.1 Gene:AT4G16146 / 827304 AraportID:AT4G16146 Length:102 Species:Arabidopsis thaliana


Alignment Length:102 Identity:25/102 - (24%)
Similarity:37/102 - (36%) Gaps:34/102 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QDTETTEQANLTDLEKIEEEKLKSKYPSGMRVPGGHSAFLQKRLQKGQK--FFDSGDYQMAKQKG 78
            |..|:|..||              ||       ||.....:..:.|..|  ||||.|:.:.||:.
plant    15 QQQESTSGAN--------------KY-------GGLVPKKKPLISKDSKRAFFDSADWALLKQEA 58

  Fly    79 GGVKQVFANKVTTGEAI----PTPETVPARKTSIIQP 111
            ...::..|       ||    |..:..|.::.|..:|
plant    59 SIDQRTIA-------AIEKLRPKLQRTPRKQLSPRRP 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
endosNP_001246745.1 Endosulfine 33..117 CDD:282515 20/85 (24%)
AT4G16146NP_567486.1 Endosulfine 11..89 CDD:282515 25/102 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1494565at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.