DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment endos and Arpp19

DIOPT Version :9

Sequence 1:NP_001246745.1 Gene:endos / 39554 FlyBaseID:FBgn0061515 Length:119 Species:Drosophila melanogaster
Sequence 2:XP_038937974.1 Gene:Arpp19 / 60336 RGDID:71054 Length:161 Species:Rattus norvegicus


Alignment Length:120 Identity:54/120 - (45%)
Similarity:70/120 - (58%) Gaps:18/120 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSAEENSN--------SPATTPQDTETTEQANLTDLEKIEEEKLKSKYPSGMRVPGGHSAFLQKR 58
            :||||..:        .|..:.|:.|.    .:|..||.||.|||::||...:.||| |.||:||
  Rat    42 ASAEEQKDVVFPPEALGPLVSLQEMED----KVTSPEKAEEAKLKARYPHLGQKPGG-SDFLRKR 101

  Fly    59 LQKGQKFFDSGDYQMAKQKGGGVKQVFA----NKVTTGEAIPTPETVPARKTSII 109
            ||||||:||||||.|||.|... ||:.|    ....||:.||||:.:|.||.|::
  Rat   102 LQKGQKYFDSGDYNMAKAKMKN-KQLPAAAPDKTEVTGDHIPTPQDLPQRKPSLV 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
endosNP_001246745.1 Endosulfine 33..117 CDD:282515 44/81 (54%)
Arpp19XP_038937974.1 Endosulfine 77..152 CDD:398375 42/76 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I8920
eggNOG 1 0.900 - - E1_KOG4076
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I5016
OMA 1 1.010 - - QHG49098
OrthoDB 1 1.010 - - D1494565at2759
OrthoFinder 1 1.000 - - FOG0002070
OrthoInspector 1 1.000 - - otm46184
orthoMCL 1 0.900 - - OOG6_105525
Panther 1 1.100 - - LDO PTHR10358
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1198
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.