DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment endos and Ensa

DIOPT Version :9

Sequence 1:NP_001246745.1 Gene:endos / 39554 FlyBaseID:FBgn0061515 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_068614.1 Gene:Ensa / 60334 RGDID:62007 Length:121 Species:Rattus norvegicus


Alignment Length:112 Identity:53/112 - (47%)
Similarity:71/112 - (63%) Gaps:4/112 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSAEENSNSPATTPQDTETTEQANLTDLEKIEEEKLKSKYPSGMRVPGGHSAFLQKRLQKGQKF 65
            ||..:|..|....|.::.:.|::......||.||.|||:||||..:.||| |.||.||||||||:
  Rat     1 MSQKQEEENPAEETGEEKQDTQEKEGILPEKAEEAKLKAKYPSLGQKPGG-SDFLMKRLQKGQKY 64

  Fly    66 FDSGDYQM--AKQKGGGVKQVFANK-VTTGEAIPTPETVPARKTSII 109
            ||||||.|  ||.|...:....|:| :.||:.||||:.:|.||:|::
  Rat    65 FDSGDYNMAKAKMKNKQLPSAGADKNLVTGDHIPTPQDLPQRKSSLV 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
endosNP_001246745.1 Endosulfine 33..117 CDD:282515 45/80 (56%)
EnsaNP_068614.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53 21/52 (40%)
Endosulfine 33..>86 CDD:398375 33/53 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..121 12/33 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I8920
eggNOG 1 0.900 - - E1_KOG4076
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I5016
OMA 1 1.010 - - QHG49098
OrthoDB 1 1.010 - - D1494565at2759
OrthoFinder 1 1.000 - - FOG0002070
OrthoInspector 1 1.000 - - otm46184
orthoMCL 1 0.900 - - OOG6_105525
Panther 1 1.100 - - O PTHR10358
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1198
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.880

Return to query results.
Submit another query.