DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment endos and Arpp19

DIOPT Version :9

Sequence 1:NP_001246745.1 Gene:endos / 39554 FlyBaseID:FBgn0061515 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001136127.1 Gene:Arpp19 / 59046 MGIID:1891691 Length:145 Species:Mus musculus


Alignment Length:113 Identity:52/113 - (46%)
Similarity:66/113 - (58%) Gaps:10/113 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EENSNSPATTPQDTETTEQANLTDL----EKIEEEKLKSKYPSGMRVPGGHSAFLQKRLQKGQKF 65
            :..|...|..|:.....||..:.|.    ||.||.|||::||...:.||| |.||:||||||||:
Mouse    29 DRRSTMSAEVPEAASAEEQKEMEDKVTSPEKAEEAKLKARYPHLGQKPGG-SDFLRKRLQKGQKY 92

  Fly    66 FDSGDYQMAKQKGGGVKQVFA----NKVTTGEAIPTPETVPARKTSII 109
            ||||||.|||.|... ||:.|    ....||:.||||:.:|.||.|::
Mouse    93 FDSGDYNMAKAKMKN-KQLPAAAPDKTEVTGDHIPTPQDLPQRKPSLV 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
endosNP_001246745.1 Endosulfine 33..117 CDD:282515 44/81 (54%)
Arpp19NP_001136127.1 Endosulfine 61..136 CDD:398375 42/76 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I9129
eggNOG 1 0.900 - - E1_KOG4076
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I5090
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49098
OrthoDB 1 1.010 - - D1494565at2759
OrthoFinder 1 1.000 - - FOG0002070
OrthoInspector 1 1.000 - - otm44091
orthoMCL 1 0.900 - - OOG6_105525
Panther 1 1.100 - - LDO PTHR10358
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1825
SonicParanoid 1 1.000 - - X1198
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.870

Return to query results.
Submit another query.