DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment endos and ensaa

DIOPT Version :9

Sequence 1:NP_001246745.1 Gene:endos / 39554 FlyBaseID:FBgn0061515 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001038649.1 Gene:ensaa / 569530 ZFINID:ZDB-GENE-060503-181 Length:124 Species:Danio rerio


Alignment Length:115 Identity:53/115 - (46%)
Similarity:63/115 - (54%) Gaps:21/115 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PQDTETTEQANLTDL-----------EKI------EEEKLKSKYPSGMRVPGGHSAFLQKRLQKG 62
            |.|.|...:....:|           ||.      ||.|||:||||....||| |.||.||||||
Zfish     5 PDDLELESEEKQCELKSGCVYLQDSPEKTCNPILSEEAKLKAKYPSLGHKPGG-SDFLMKRLQKG 68

  Fly    63 QKFFDSGDYQM--AKQKGGGVKQVFANK-VTTGEAIPTPETVPARKTSII 109
            ||:||||||.|  ||.|...|.|..|.| :.||:.||||:.:|.||.:|:
Zfish    69 QKYFDSGDYNMAKAKMKSKHVVQSAAEKSLVTGDHIPTPQDLPQRKNTIL 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
endosNP_001246745.1 Endosulfine 33..117 CDD:282515 47/80 (59%)
ensaaNP_001038649.1 Endosulfine 40..115 CDD:282515 45/75 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 99..124 10/20 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8873
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5153
OMA 1 1.010 - - QHG49098
OrthoDB 1 1.010 - - D1494565at2759
OrthoFinder 1 1.000 - - FOG0002070
OrthoInspector 1 1.000 - - otm24791
orthoMCL 1 0.900 - - OOG6_105525
Panther 1 1.100 - - O PTHR10358
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1198
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.980

Return to query results.
Submit another query.