DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment endos and ensa

DIOPT Version :9

Sequence 1:NP_001246745.1 Gene:endos / 39554 FlyBaseID:FBgn0061515 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_998845.1 Gene:ensa / 407936 XenbaseID:XB-GENE-943824 Length:125 Species:Xenopus tropicalis


Alignment Length:106 Identity:47/106 - (44%)
Similarity:65/106 - (61%) Gaps:18/106 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TPQDTETTEQANLTDLEKIEEEKLKSKYPSGMRVPGGHSAFLQKRLQKGQKFFDSGDYQMAKQKG 78
            |.::.:.:::......||.||:|||:|||:..:.||| |.||.||||||||:||||||.|||.| 
 Frog    14 TGEEKQDSQEKEAVTPEKAEEQKLKAKYPNLGQKPGG-SDFLMKRLQKGQKYFDSGDYNMAKAK- 76

  Fly    79 GGVKQVFANK----------VTTGEAIPTPETVPARKTSII 109
                  ..||          :.||:.||||:.:|.||:|::
 Frog    77 ------MKNKQLPCAGPDKNLVTGDHIPTPQDLPQRKSSLV 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
endosNP_001246745.1 Endosulfine 33..117 CDD:282515 44/87 (51%)
ensaNP_998845.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53 15/39 (38%)
Endosulfine 33..>81 CDD:368046 33/55 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..108 8/26 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8798
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I4997
OMA 1 1.010 - - QHG49098
OrthoDB 1 1.010 - - D1494565at2759
OrthoFinder 1 1.000 - - FOG0002070
OrthoInspector 1 1.000 - - otm49268
Panther 1 1.100 - - O PTHR10358
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1825
SonicParanoid 1 1.000 - - X1198
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.