DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment endos and arpp19a

DIOPT Version :9

Sequence 1:NP_001246745.1 Gene:endos / 39554 FlyBaseID:FBgn0061515 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_956924.1 Gene:arpp19a / 393603 ZFINID:ZDB-GENE-040426-1281 Length:111 Species:Danio rerio


Alignment Length:101 Identity:51/101 - (50%)
Similarity:64/101 - (63%) Gaps:9/101 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QDTETTEQ---ANLTDLEKIEEEKLKSKYPSGMRVPGGHSAFLQKRLQKGQKFFDSGDYQMAKQK 77
            ::|...||   .|...|||:||.|||:|||.....||| |..|:||||||.|:||||||.|||.|
Zfish     7 EETNVAEQKDEENKICLEKMEEAKLKAKYPHLGNKPGG-SDLLRKRLQKGPKYFDSGDYNMAKAK 70

  Fly    78 GGGVKQVFANKV----TTGEAIPTPETVPARKTSII 109
            ... ||:.|.:.    .||:.||||:.:|.||||::
Zfish    71 IKN-KQLPAAQTEKAEITGDHIPTPQDLPQRKTSLV 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
endosNP_001246745.1 Endosulfine 33..117 CDD:282515 44/81 (54%)
arpp19aNP_956924.1 Endosulfine 27..99 CDD:282515 39/73 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8873
eggNOG 1 0.900 - - E1_KOG4076
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5153
OMA 1 1.010 - - QHG49098
OrthoDB 1 1.010 - - D1494565at2759
OrthoFinder 1 1.000 - - FOG0002070
OrthoInspector 1 1.000 - - otm24791
orthoMCL 1 0.900 - - OOG6_105525
Panther 1 1.100 - - O PTHR10358
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1198
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.