DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment endos and ENSA

DIOPT Version :9

Sequence 1:NP_001246745.1 Gene:endos / 39554 FlyBaseID:FBgn0061515 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_996925.1 Gene:ENSA / 2029 HGNCID:3360 Length:137 Species:Homo sapiens


Alignment Length:135 Identity:52/135 - (38%)
Similarity:69/135 - (51%) Gaps:34/135 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSAEENSNSPATTPQDTETTEQANLTDLEKIEEEKLKSKYPSGMRVPGGHSAFLQKRLQKG--- 62
            ||..:|..|....|.::.:.|::......|:.||.|||:||||..:.||| |.||.||||||   
Human     1 MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGG-SDFLMKRLQKGDYK 64

  Fly    63 -------------QKFFDSGDYQMAKQKGGGVKQVFANK----------VTTGEAIPTPETVPAR 104
                         ||:||||||.|||.|       ..||          :.||:.||||:.:|.|
Human    65 SLHWSVLLCADEMQKYFDSGDYNMAKAK-------MKNKQLPSAGPDKNLVTGDHIPTPQDLPQR 122

  Fly   105 KTSII 109
            |:|::
Human   123 KSSLV 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
endosNP_001246745.1 Endosulfine 33..117 CDD:282515 45/103 (44%)
ENSANP_996925.1 Endosulfine 33..121 CDD:282515 41/95 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I9350
eggNOG 1 0.900 - - E1_KOG4076
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 90 1.000 Inparanoid score I5116
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49098
OrthoDB 1 1.010 - - D1494565at2759
OrthoFinder 1 1.000 - - FOG0002070
OrthoInspector 1 1.000 - - otm42038
orthoMCL 1 0.900 - - OOG6_105525
Panther 1 1.100 - - O PTHR10358
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1825
SonicParanoid 1 1.000 - - X1198
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.