DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment endos and ensa-1

DIOPT Version :9

Sequence 1:NP_001246745.1 Gene:endos / 39554 FlyBaseID:FBgn0061515 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_492609.1 Gene:ensa-1 / 172837 WormBaseID:WBGene00010730 Length:174 Species:Caenorhabditis elegans


Alignment Length:137 Identity:45/137 - (32%)
Similarity:57/137 - (41%) Gaps:50/137 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EKIEEEKLKSKYPSGMRVPG-GHSAFLQKRLQKGQKFFDSGDYQMAKQKGG---GVK-------- 82
            ||.:|::|..|..:..::|. ..|:||||:||: :||||||||.|.|.|.|   |.|        
 Worm    23 EKQQEQELMGKLAATGKLPARPASSFLQKKLQQ-RKFFDSGDYAMDKSKAGTGLGSKPHPLAGGP 86

  Fly    83 -----QVFANKVTTGEA-----------------------------IPTPETVPARKTSIIQP-- 111
                 .|.|.:.....|                             ||.|:|||.||.|||.|  
 Worm    87 PPAAPPVVAQRSPAPAATTPSPSASPISQQTNRPSSDRNSDDDNLQIPRPDTVPQRKASIINPSV 151

  Fly   112 -CNKFPA 117
             |...||
 Worm   152 HCKLSPA 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
endosNP_001246745.1 Endosulfine 33..117 CDD:282515 41/132 (31%)
ensa-1NP_492609.1 Endosulfine 16..>81 CDD:282515 27/58 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4076
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I4139
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1494565at2759
OrthoFinder 1 1.000 - - FOG0002070
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105525
Panther 1 1.100 - - LDO PTHR10358
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1825
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.