DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment endos and LOC100360828

DIOPT Version :9

Sequence 1:NP_001246745.1 Gene:endos / 39554 FlyBaseID:FBgn0061515 Length:119 Species:Drosophila melanogaster
Sequence 2:XP_002730018.2 Gene:LOC100360828 / 100360828 RGDID:2321330 Length:112 Species:Rattus norvegicus


Alignment Length:106 Identity:51/106 - (48%)
Similarity:64/106 - (60%) Gaps:10/106 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ATTPQDTETTEQANLTDL----EKIEEEKLKSKYPSGMRVPGGHSAFLQKRLQKGQKFFDSGDYQ 72
            |..|:.....||..:.|.    ||.||.|||::||...:.||| |.||:||||||||:||||||.
  Rat     3 AEVPEAASAEEQKEMEDKVTSPEKAEEAKLKARYPHLGQKPGG-SDFLRKRLQKGQKYFDSGDYN 66

  Fly    73 MAKQKGGGVKQVFA----NKVTTGEAIPTPETVPARKTSII 109
            |||.|... ||:.|    ....||:.||||:.:|.||.|::
  Rat    67 MAKAKMKN-KQLPAAAPDKTEVTGDHIPTPQDLPQRKPSLV 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
endosNP_001246745.1 Endosulfine 33..117 CDD:282515 44/81 (54%)
LOC100360828XP_002730018.2 Endosulfine 28..103 CDD:398375 42/76 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I8920
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I5016
OMA 1 1.010 - - QHG49098
OrthoDB 1 1.010 - - D1494565at2759
OrthoFinder 1 1.000 - - FOG0002070
OrthoInspector 1 1.000 - - otm46184
orthoMCL 1 0.900 - - OOG6_105525
Panther 1 1.100 - - LDO PTHR10358
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1198
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.980

Return to query results.
Submit another query.