DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment endos and ensab

DIOPT Version :9

Sequence 1:NP_001246745.1 Gene:endos / 39554 FlyBaseID:FBgn0061515 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001243660.1 Gene:ensab / 100317933 ZFINID:ZDB-GENE-060526-294 Length:117 Species:Danio rerio


Alignment Length:116 Identity:52/116 - (44%)
Similarity:74/116 - (63%) Gaps:12/116 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSAEENSNSPATTPQDTETTEQANLTDLEKI--EEEKLKSKYPSGMRVPGGHSAFLQKRLQKGQ 63
            |||..:::.   |.|:..:.|:::..|:...:  ||.|||:|||:..:.||| |.||.|||||||
Zfish     1 MSSDNQDTE---THPEQVDETQESQDTNSNPVRTEEAKLKAKYPNLGQKPGG-SDFLMKRLQKGQ 61

  Fly    64 KFFDSGDYQMAKQKGGGVKQVFA-----NKVTTGEAIPTPETVPARKTSII 109
            |:||||||.|||.|... ||:.|     ..:.||:.||||:.:|.||:|::
Zfish    62 KYFDSGDYNMAKAKMKN-KQLPAAAGPDKNIVTGDHIPTPQDLPQRKSSLV 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
endosNP_001246745.1 Endosulfine 33..117 CDD:282515 45/82 (55%)
ensabNP_001243660.1 Endosulfine 32..105 CDD:282515 41/74 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8873
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5153
OMA 1 1.010 - - QHG49098
OrthoDB 1 1.010 - - D1494565at2759
OrthoFinder 1 1.000 - - FOG0002070
OrthoInspector 1 1.000 - - otm24791
orthoMCL 1 0.900 - - OOG6_105525
Panther 1 1.100 - - O PTHR10358
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1825
SonicParanoid 1 1.000 - - X1198
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1212.010

Return to query results.
Submit another query.