DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptip and MEI1

DIOPT Version :9

Sequence 1:NP_729947.2 Gene:Ptip / 39552 FlyBaseID:FBgn0052133 Length:2294 Species:Drosophila melanogaster
Sequence 2:NP_001323210.1 Gene:MEI1 / 844068 AraportID:AT1G77320 Length:1001 Species:Arabidopsis thaliana


Alignment Length:320 Identity:62/320 - (19%)
Similarity:118/320 - (36%) Gaps:57/320 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EIERFLKSGGAQSKLFLSDQITH-----MICATNYNEEELSMNLDLYSAIPVTEQWIVHSAKLG- 83
            :|..::..||.:   .::|.:.:     :.|...:...|.:      ..|.|:..|:.:..|:| 
plant   587 QIVEWVNQGGGE---VVNDPLINNAHFTIECHGGFQSTETT------QTIYVSSHWVRNCLKVGC 642

  Fly    84 --RMASTRAFDPSPNQMRLMRGIRVAITNVVAGDR-----RRLYAMLTYHGAVVTHSFGATNTHL 141
              .::|...:.|.|.|..|.....:.|.:....::     |.|..:|   ||..........|||
plant   643 LLAVSSHILYSPLPCQTPLPGFESLCICSSQHNEKNVELLRNLSVVL---GADFVERLTRKVTHL 704

  Fly   142 VCGAANGGIYNKALALPKNAIIIVTPDWVTDSLKYKNCMPVETYHPRLLKPIEKQRTQKQQATQQ 206
            :|..|.|..|.:|   .|..||.|||||:.:.::....:..:.:|||.|      .||.::|..|
plant   705 ICNFAKGDKYVRA---SKWGIISVTPDWLYECVRQNQVVCTDNFHPREL------TTQDREAGSQ 760

  Fly   207 QQIQ-------QQQQLQHQHQMQQQQQQQ-------------QQQQQQQQQQQQQQQQQQQQQQQ 251
            ...|       ....|...|...:::.|.             .:..:..::|....::.:..:..
plant   761 FHTQFVPMASRDSMSLPVSHSEDREKIQSFAGKSGCGKGEVYNRLGEIGKEQTFPSKKAKLLRDG 825

  Fly   252 QQQQQHQQQIIQQQATATSALSDILGFGEDSVAAKSIASIKSQLQASAEQ---IQQQQLP 308
            |:......:.:.......|...|.:..|.|..:.:.:..:...::...||   ||.|:.|
plant   826 QESDVFPVRELPSNCDRPSHSGDGIVTGYDVASGREVPDVADTIEDLLEQTSKIQDQKSP 885

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PtipNP_729947.2 BRCT 9..77 CDD:214602 9/56 (16%)
BRCT 96..174 CDD:278934 24/82 (29%)
BRCT 1814..1887 CDD:237994
PTCB-BRCT 1914..1976 CDD:289507
BRCT <2087..2142 CDD:237994
BRCT 2175..2265 CDD:278934
MEI1NP_001323210.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D557169at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.