DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptip and AT1G67180

DIOPT Version :10

Sequence 1:NP_729947.2 Gene:Ptip / 39552 FlyBaseID:FBgn0052133 Length:2294 Species:Drosophila melanogaster
Sequence 2:NP_176889.1 Gene:AT1G67180 / 843038 AraportID:AT1G67180 Length:453 Species:Arabidopsis thaliana


Alignment Length:137 Identity:35/137 - (25%)
Similarity:61/137 - (44%) Gaps:10/137 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly  1911 LERYIITSEGFEGEEVVRLQQMAEECGAIYTSYLSKVNTVVVCKQLEGNKFNAAKEWNIPMVNAL 1975
            :|..:.|..|:.|.:..:|.::....||.|...:|:..|.:||.:.||.|::.||::...:||..
plant     1 MENVVATVSGYHGSDRFKLIKLISHSGASYVGAMSRSITHLVCWKFEGKKYDLAKKFGTVVVNHR 65

  Fly  1976 WLSDVCIGNLSGLSQYENP-KYQQYNLVAPFRIECNLVAHLLTAWKAPINLTQEAHERVKRHLSD 2039
            |:.: |:  ..|....|.| .:.....|.|..||...|:......|.    ..:|.|...::.|:
plant    66 WVEE-CV--KEGRRVSETPYMFDSGEEVGPLMIELPAVSEEAKVTKK----VNKASETFDKYFSN 123

  Fly  2040 PYGNEQK 2046
              |.|.:
plant   124 --GGENR 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PtipNP_729947.2 BRCT_PAXIP1_rpt1 11..87 CDD:349346
BRCT_PAXIP1_rpt2 100..181 CDD:349342
BRCT_PAXIP1_rpt3 1814..1893 CDD:349343
BRCT_PAXIP1_rpt4 1914..1986 CDD:349362 20/71 (28%)
BRCT_PAXIP1_rpt5 2075..2147 CDD:349344
BRCT_PAXIP1_rpt6 2179..2271 CDD:349393
AT1G67180NP_176889.1 BRCT 4..76 CDD:469589 21/74 (28%)
RING_Ubox 295..345 CDD:473075
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.