DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment upSET and MMD1

DIOPT Version :9

Sequence 1:NP_001261819.1 Gene:upSET / 39551 FlyBaseID:FBgn0036398 Length:3146 Species:Drosophila melanogaster
Sequence 2:NP_176791.2 Gene:MMD1 / 842932 AraportID:AT1G66170 Length:704 Species:Arabidopsis thaliana


Alignment Length:241 Identity:59/241 - (24%)
Similarity:88/241 - (36%) Gaps:54/241 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   717 EELYIEEVRPVPVLTQ---------DLRLQQLHAIMQDHTYASQQQQQQPQQAAGDT-------- 764
            |.:.:||:.|:.:||.         ||.|...:.::   .|...:..:...||..|:        
plant   436 EAVVLEEITPLRILTPLKPGADVYGDLLLLYTNVLL---NYPESELVRSATQAILDSKHFIKEWP 497

  Fly   765 --------------TNPGAAQQVQQPQQWSL-GGIGVTVSGSQGT---------PTAVGGYCSYF 805
                          .||... .|:..|...| .|..|||. .|.|         .|....||...
plant   498 IWDNNDTVLQFLCRINPSLV-DVRSEQTTELPPGELVTVP-LQATVYDLKQAIEETFRDTYCILS 560

  Fly   806 GQQIARSQADDDAHSAISSSSRMGLASTDIDPGEETETAPEAEAEDDS-VTRCICELTHDDG-YM 868
            ...:......::..|.|.|.|.:.:....||    .|:..:.:...|: :.:|||....||| .|
plant   561 NFVVTEIDEVEEDMSLIGSCSALTVRGHGID----LESKLKCQGGCDTWMVKCICRARDDDGERM 621

  Fly   869 ICCDKCSAWQHVDCMGI-DRQNIPEEYMCELCQPRAVDKARARALQ 913
            |.||.|..|||..|.|| |...:|..::|..|.....::.| :.||
plant   622 ISCDVCEVWQHTRCCGIDDSDTLPPLFVCSNCCEEFAEQQR-KVLQ 666

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
upSETNP_001261819.1 PHD_MLL5 856..899 CDD:277025 20/44 (45%)
SET <1221..1273 CDD:214614
MMD1NP_176791.2 PHD_MMD1_like 608..653 CDD:277031 20/44 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1844
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.