DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment upSET and cti6

DIOPT Version :9

Sequence 1:NP_001261819.1 Gene:upSET / 39551 FlyBaseID:FBgn0036398 Length:3146 Species:Drosophila melanogaster
Sequence 2:NP_595212.1 Gene:cti6 / 2539769 PomBaseID:SPBC1685.08 Length:424 Species:Schizosaccharomyces pombe


Alignment Length:401 Identity:91/401 - (22%)
Similarity:130/401 - (32%) Gaps:126/401 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   835 IDPGEETETAPEAEAEDDSVTRCICELTHDD------GYMICCDKCSAWQHVDCMGI-DRQNIPE 892
            :...||.||:...|     ||||:|.:...|      |..|.||:||.|||.:|:|. |...:||
pombe    34 VSDNEENETSSTGE-----VTRCVCGIVESDDEASDGGLYIQCDQCSVWQHGNCVGFADESEVPE 93

  Fly   893 EYMCELCQPR--------------------------------------AVDKARARALQRQKRK- 918
            .|.||:|.|.                                      |..|:..:.|....|. 
pombe    94 VYYCEICHPEFHKVYQRGRGAKQSKYLGNGKPIEASQTEESSSTPPSPATKKSSKQRLTMNSRDA 158

  Fly   919 ----EHMLLVATQAANGAAAVAAGTTLSGGLGSGLPMSEELQHRLASGLNGGFATGTGM------ 973
                |..|.:|.:.:. ....:.|.|.|..|....|..|              :.||.:      
pombe   159 ALDYEEYLAIAKEKSL-IPRRSRGRTSSKSLSPPAPQDE--------------SQGTEINLKQKI 208

  Fly   974 ----------SKKSKKTKENSGSTSTL---------KKTKKSAVGMGGE-----KNASGSGTPTG 1014
                      ||:||...|.:..|||.         ::|..:...:..|     |..||..:|..
pombe   209 EEENDEILEDSKESKDENEENKETSTTNVAETDAPEEETVDTVEEIADEEKHSVKEESGEASPQS 273

  Fly  1015 SSGKT---------SKKSSKRKSKSGGDGSSGGGSSPALTAAEKHAANLRQWIENYEYAVTNHYS 1070
            |...|         |.:.:||::.:..........:|..:...|......:...|     .||..
pombe   274 SQQSTITSISTTTRSTRKAKREAAAEDKADLPAAVAPKPSKTRKVGGRRGKSSSN-----DNHRI 333

  Fly  1071 PELR---ARLHAIQKQPSLLQSIQNTENKALRQIQQQLSTAGSAEQLEQRAQLIPYAGAKVLISS 1132
            |:|.   ..:..|.|...|...|..||.:  |::...|...|.. |:|..||   .||.:   ||
pombe   334 PQLHPDGTFVETITKPKGLHSRITMTEMR--RRVASMLEYIGHI-QVEMAAQ---SAGNQ---SS 389

  Fly  1133 VDLSPHAPIHE 1143
            ...|...|..|
pombe   390 TKSSKEGPEEE 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
upSETNP_001261819.1 PHD_MLL5 856..899 CDD:277025 21/49 (43%)
SET <1221..1273 CDD:214614
cti6NP_595212.1 PHD_SF 50..100 CDD:304600 21/49 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1844
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4489
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.