DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment upSET and mes-4

DIOPT Version :9

Sequence 1:NP_001261819.1 Gene:upSET / 39551 FlyBaseID:FBgn0036398 Length:3146 Species:Drosophila melanogaster
Sequence 2:NP_506333.1 Gene:mes-4 / 179824 WormBaseID:WBGene00003222 Length:898 Species:Caenorhabditis elegans


Alignment Length:322 Identity:77/322 - (23%)
Similarity:123/322 - (38%) Gaps:87/322 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  2400 IPAASNATTSAVTNTA----AASLTTTTAPSSTKNLTEHDIQERLLSFHAANISYLQS-RNKKAT 2459
            :.||.....|...|.:    |||..|......||..:.:|.:           ||::: |.....
 Worm   604 VDAARYGNISRYINHSCDPNAASFVTKVFVKKTKEGSLYDTR-----------SYIRAIRTIDDG 657

  Fly  2460 AALT-SASPSQKSNSSSGGSGTES-----KKSSKDKDEKRD-KEKQLKKSKKEKKKS-KDKEKQK 2516
            ..:| |.:.:.:.|......|.|:     .|:.::|.|..| .||..||:|..|||| |::.::.
 Worm   658 DEITFSYNMNNEENLPDCECGAENCMGTMGKAKREKPEVADSSEKAAKKNKSSKKKSVKNQNRKS 722

  Fly  2517 AAVNVNSTSQIVDTKKKTTQPSKPDSKSSIAPVLV-PPSLPVATANGKTKHTAYNNVDQQQQQQM 2580
            .....|.|:    :||....||||.:.|:.:...| ..|.|::                |.::.:
 Worm   723 QEAGKNGTA----SKKSEISPSKPSTSSASSTSFVQQASWPIS----------------QNKKNL 767

  Fly  2581 RRRTMSMCITPVTPTPVVTPSPLHGTPPSTKKRQTNFE---QELTKPNSQILSSSILLNSSKGLG 2642
            ::.:..    ||..|         |:..|| ..:.||.   |||..|    :||.....||    
 Worm   768 KKNSNQ----PVADT---------GSTLST-STELNFHEKPQELLSP----VSSRSRAASS---- 810

  Fly  2643 LPLAAPTVVSVPTAVQQQQHRKENNHQEATPASGGPMSLAAAIASGKL-------NAISRRR 2697
                     |.|.| |:.:.|:::...||.|......||.....:||.       :||::.|
 Worm   811 ---------STPRA-QKSKSRRDDVESEAPPVKRATPSLQTIQETGKAIEFPATKSAITKAR 862

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
upSETNP_001261819.1 PHD_MLL5 856..899 CDD:277025
SET <1221..1273 CDD:214614
mes-4NP_506333.1 PHD_SF 207..269 CDD:304600
SET 537..671 CDD:214614 16/77 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4489
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.