DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment upSET and Y14H12B.2

DIOPT Version :9

Sequence 1:NP_001261819.1 Gene:upSET / 39551 FlyBaseID:FBgn0036398 Length:3146 Species:Drosophila melanogaster
Sequence 2:NP_494697.1 Gene:Y14H12B.2 / 173735 WormBaseID:WBGene00021192 Length:414 Species:Caenorhabditis elegans


Alignment Length:310 Identity:67/310 - (21%)
Similarity:110/310 - (35%) Gaps:68/310 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  2318 SKKEPTKVEPKPGESLLRSTATVTATPTAATIAATTLLD-VSKVAFKTRPPLKLEDEPQKKKPKL 2381
            :|....||..|.|:|             |..:..:..|| ::|.:.....||.|:|.....|.  
 Worm     4 NKSSGRKVMKKRGKS-------------AKAVDMSHFLDFLAKKSKNISRPLMLKDLFSAYKE-- 53

  Fly  2382 ESILPAPVATVP-----PVSVPPIPAASNATTSAVTNTAAASLTTTTAPSS-TKNLTEH-----D 2435
            |:..|..|||:.     .::| .||.|:|...........|  |:|:|... .|.|.|.     |
 Worm    54 EAGYPGTVATLRLKLRWDLAV-KIPLAANFEDDEKAQMLFA--TSTSAKEEFLKRLREKATVDVD 115

  Fly  2436 IQERLLSFHAANISYLQSRNKKATAALTSASPSQKSNSSSGGSGTESKK-SSKDKDEKRDKEKQL 2499
            ..:|:..:.:..:.:.....|...|.|:....|..||.|...|..:.:: :|.|..|:.|:::.:
 Worm   116 NLQRITYYKSTKLEFKGKHAKGNFADLSQRRSSSASNQSVAQSPPQLQQINSADLQEEEDEDEII 180

  Fly  2500 KKSKKEKKKSKDKEKQKAAVNVNSTSQI-VDTKKKTTQPSKPDSKSSIAPVLVPPSLPVATANGK 2563
            ...          :....|:|.....|| |.|:.:..:...|.|..|       .::.|...|..
 Worm   181 VID----------QTSNPAINYPKMKQIAVKTEFQEPRIDYPPSDGS-------DTISVINVNAG 228

  Fly  2564 -----TKHTAYNNVDQ--------------QQQQQMRRRTMSMCITPVTP 2594
                 .:...|.|||:              |.|.||.:..::...|...|
 Worm   229 YSLYCPQPAFYPNVDRSMFTAMGQMMTGVLQMQSQMMKEVLNRGSTSAPP 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
upSETNP_001261819.1 PHD_MLL5 856..899 CDD:277025
SET <1221..1273 CDD:214614
Y14H12B.2NP_494697.1 SPK 27..131 CDD:367941 27/108 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1844
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.