| Sequence 1: | NP_648679.1 | Gene: | CG17359 / 39549 | FlyBaseID: | FBgn0036396 | Length: | 339 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_219363.2 | Gene: | ZNF764 / 92595 | HGNCID: | 28200 | Length: | 408 | Species: | Homo sapiens |
| Alignment Length: | 226 | Identity: | 72/226 - (31%) |
|---|---|---|---|
| Similarity: | 106/226 - (46%) | Gaps: | 43/226 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 142 EPKPISSPLPDNNEHKLAQSYSP------AKTPHN------------KSKRRARSYSDNDSWSPD 188
Fly 189 SEL-EH---EDDDKIWNASKRGKP-------------KRVPGPYRCKLCTQSFTQKQNLEIHMRI 236
Fly 237 HTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKC 301
Fly 302 SKCQQSFKQLNGLQKHMSAHTRGKRRTSSQE 332 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG17359 | NP_648679.1 | zf-AD | 6..88 | CDD:285071 | |
| zf-C2H2 | 215..237 | CDD:278523 | 9/21 (43%) | ||
| C2H2 Zn finger | 217..237 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 229..254 | CDD:290200 | 13/24 (54%) | ||
| C2H2 Zn finger | 245..265 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 257..282 | CDD:290200 | 12/24 (50%) | ||
| C2H2 Zn finger | 273..293 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 286..310 | CDD:290200 | 12/23 (52%) | ||
| C2H2 Zn finger | 301..321 | CDD:275368 | 5/19 (26%) | ||
| ZNF764 | NP_219363.2 | zf-H2C2_2 | 301..326 | CDD:290200 | 12/24 (50%) |
| C2H2 Zn finger | 317..337 | CDD:275368 | 9/27 (33%) | ||
| zf-H2C2_2 | 333..352 | CDD:290200 | 6/12 (50%) | ||
| C2H2 Zn finger | 345..365 | CDD:275368 | |||
| KRAB | 26..85 | CDD:214630 | |||
| KRAB | 26..65 | CDD:279668 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 91..167 | 7/43 (16%) | |||
| C2H2 Zn finger | 177..197 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 190..212 | CDD:290200 | 6/21 (29%) | ||
| C2H2 Zn finger | 205..225 | CDD:275368 | 2/19 (11%) | ||
| zf-H2C2_2 | 217..242 | CDD:290200 | 6/24 (25%) | ||
| COG5048 | 229..>294 | CDD:227381 | 32/64 (50%) | ||
| C2H2 Zn finger | 233..253 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 245..270 | CDD:290200 | 13/24 (54%) | ||
| C2H2 Zn finger | 261..281 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 273..298 | CDD:290200 | 12/24 (50%) | ||
| COG5048 | 285..>350 | CDD:227381 | 27/64 (42%) | ||
| C2H2 Zn finger | 289..309 | CDD:275368 | 7/19 (37%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||