DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and STP3

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_013479.3 Gene:STP3 / 851089 SGDID:S000004367 Length:343 Species:Saccharomyces cerevisiae


Alignment Length:242 Identity:47/242 - (19%)
Similarity:67/242 - (27%) Gaps:104/242 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 PHNKSKRRARSYSDNDSWSPDSELEHEDDDKIWNASKRGKPKR-------VPGP----------- 214
            ||:....|:.|.|   |:.|..:...|........|....|.|       |.||           
Yeast    69 PHSNDVSRSNSSS---SFLPSVQQPTEGSASASETSSSASPSRSISPILKVAGPSSVGGAGVSTP 130

  Fly   215 -----------YRCKLCTQSFTQKQNLEIHMRIH--TGERPYKCSLCPRSFAQKGNLQSHTRCHT 266
                       .:|.:|...:.   ||..|...|  ..:||:||.:|.|.||:..:|..|.:.|.
Yeast   131 HSTKINKPRKKKQCPICRNFYA---NLTTHKATHLTPEDRPHKCPICHRGFARNNDLLRHKKRHW 192

  Fly   267 GERPFGCPNCPKRFRQVGQLQVHT------------RTHTGEQP-------------------FK 300
            .:         :...|.|.|..|.            .||....|                   ||
Yeast   193 KD---------EILSQSGVLSNHNDGKGGSVSPNDDDTHEKMTPMNSVTDYAQLKSLHQIKGTFK 248

  Fly   301 C-------------------------SKCQQS--FKQLNGLQKHMSA 320
            |                         |.|.|:  |.:.:..:.|:.|
Yeast   249 CPFNSTLIQLDMDMYPYKLKPLNFETSNCHQTGVFSRCDTFKNHLKA 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071
zf-C2H2 215..237 CDD:278523 5/21 (24%)
C2H2 Zn finger 217..237 CDD:275368 5/19 (26%)
zf-H2C2_2 229..254 CDD:290200 11/26 (42%)
C2H2 Zn finger 245..265 CDD:275368 7/19 (37%)
zf-H2C2_2 257..282 CDD:290200 3/24 (13%)
C2H2 Zn finger 273..293 CDD:275368 4/31 (13%)
zf-H2C2_2 286..310 CDD:290200 12/81 (15%)
C2H2 Zn finger 301..321 CDD:275368 7/47 (15%)
STP3NP_013479.3 COG5048 <137..295 CDD:227381 32/169 (19%)
C2H2 Zn finger 144..161 CDD:275368 5/19 (26%)
C2H2 Zn finger 171..191 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.