Sequence 1: | NP_648679.1 | Gene: | CG17359 / 39549 | FlyBaseID: | FBgn0036396 | Length: | 339 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001303907.1 | Gene: | ZBTB45 / 84878 | HGNCID: | 23715 | Length: | 511 | Species: | Homo sapiens |
Alignment Length: | 237 | Identity: | 70/237 - (29%) |
---|---|---|---|
Similarity: | 104/237 - (43%) | Gaps: | 29/237 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 106 DNIEPQMPVSVM--EAGKTPE---TSEPLLVELVQVKYMPP---EPKP--------ISSPLPDNN 154
Fly 155 EHKLAQSYSPAKTPHNKSKRRARSYSDNDSWSPDSEL-EHEDDDKIWNASKRGKPKRVPG----P 214
Fly 215 YRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKR 279
Fly 280 FRQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAH 321 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17359 | NP_648679.1 | zf-AD | 6..88 | CDD:285071 | |
zf-C2H2 | 215..237 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 217..237 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 229..254 | CDD:290200 | 13/24 (54%) | ||
C2H2 Zn finger | 245..265 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 257..282 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 273..293 | CDD:275368 | 10/19 (53%) | ||
zf-H2C2_2 | 286..310 | CDD:290200 | 10/23 (43%) | ||
C2H2 Zn finger | 301..321 | CDD:275368 | 5/19 (26%) | ||
ZBTB45 | NP_001303907.1 | BTB | 23..122 | CDD:279045 | |
BTB | 34..124 | CDD:197585 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 159..241 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 294..403 | 23/115 (20%) | |||
zf-C2H2 | 403..425 | CDD:278523 | 7/21 (33%) | ||
COG5048 | <405..>472 | CDD:227381 | 29/66 (44%) | ||
C2H2 Zn finger | 405..425 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 417..441 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 433..453 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 445..470 | CDD:290200 | 12/24 (50%) | ||
zf-C2H2 | 459..481 | CDD:278523 | 11/21 (52%) | ||
C2H2 Zn finger | 461..481 | CDD:275368 | 10/19 (53%) | ||
zf-H2C2_2 | 473..497 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 488..508 | CDD:275368 | 5/19 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S4407 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.950 |