DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and ZNF514

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001304934.1 Gene:ZNF514 / 84874 HGNCID:25894 Length:473 Species:Homo sapiens


Alignment Length:112 Identity:52/112 - (46%)
Similarity:71/112 - (63%) Gaps:0/112 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 PYRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPK 278
            ||.|..|.::|:|..:|.:|.|.||||:||||:.|.|:|....:|..|.|.||||:|:.|..|.:
Human   332 PYECSECGRAFSQSSSLVLHYRFHTGEKPYKCNECGRAFGHTSSLIKHQRTHTGEKPYECRECGR 396

  Fly   279 RFRQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHTRGK 325
            .|.|...|.||.|.||||:|:||:||.::|.|.:.|.:|...||..|
Human   397 TFSQSSSLIVHYRFHTGEKPYKCNKCGRAFSQSSSLTQHYRFHTGEK 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071
zf-C2H2 215..237 CDD:278523 8/21 (38%)
C2H2 Zn finger 217..237 CDD:275368 7/19 (37%)
zf-H2C2_2 229..254 CDD:290200 14/24 (58%)
C2H2 Zn finger 245..265 CDD:275368 7/19 (37%)
zf-H2C2_2 257..282 CDD:290200 11/24 (46%)
C2H2 Zn finger 273..293 CDD:275368 8/19 (42%)
zf-H2C2_2 286..310 CDD:290200 14/23 (61%)
C2H2 Zn finger 301..321 CDD:275368 7/19 (37%)
ZNF514NP_001304934.1 KRAB 74..134 CDD:214630
KRAB 74..111 CDD:279668
C2H2 Zn finger 279..299 CDD:275368
zf-H2C2_2 291..314 CDD:290200
COG5048 <303..463 CDD:227381 52/112 (46%)
C2H2 Zn finger 307..327 CDD:275368
zf-H2C2_2 319..344 CDD:290200 5/11 (45%)
C2H2 Zn finger 335..355 CDD:275368 7/19 (37%)
zf-H2C2_2 347..370 CDD:290200 13/22 (59%)
C2H2 Zn finger 363..383 CDD:275368 7/19 (37%)
zf-H2C2_2 375..400 CDD:290200 11/24 (46%)
C2H2 Zn finger 391..411 CDD:275368 8/19 (42%)
zf-H2C2_2 403..428 CDD:290200 14/24 (58%)
C2H2 Zn finger 419..439 CDD:275368 7/19 (37%)
zf-H2C2_2 431..456 CDD:290200 5/13 (38%)
C2H2 Zn finger 447..467 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.