DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and ZNF672

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_079112.1 Gene:ZNF672 / 79894 HGNCID:26179 Length:452 Species:Homo sapiens


Alignment Length:379 Identity:96/379 - (25%)
Similarity:140/379 - (36%) Gaps:106/379 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 YASSNRVQEQEPVLATMLRECSGCS--------------VHKEDGMPQFICVECAEAVRNAYRLR 75
            :|:|..|...:|.      .||.|.              .|..||  :|.|:||.|....|..||
Human     2 FATSGAVAAGKPY------SCSECGKSFCYSSVLLRHERAHGGDG--RFRCLECGERCARAADLR 58

  Fly    76 --------------RQCRKSHQYFEQLRLMM---KELDDIEYCLNIGDNIEPQMPVSVMEAGKTP 123
                          .:|.:|.::..:|.|.:   ::......|...|... |.:|..::...:  
Human    59 AHRRTHAGQTLYICSECGQSFRHSGRLDLHLGAHRQRCRTCPCRTCGRRF-PHLPALLLHRRR-- 120

  Fly   124 ETSEPLLVELVQVKYMPPEPK--PISSP--------LPDNNEHKLAQSYSPAKTPHN-------- 170
                         :::|..|:  |:.:.        ......|.|..:..||..||.        
Human   121 -------------QHLPERPRRCPLCARTFRQSALLFHQARAHPLGTTSDPAAPPHRCAQCPRAF 172

  Fly   171 KSKRRARSYSD-NDSWSPDSELEHEDDDKIWNASKRGKPKRVPG----------------PYRCK 218
            :|....||::. :.|.||..       .::.:|.:.|...:..|                |::|.
Human   173 RSGAGLRSHARIHVSRSPTR-------PRVSDAHQCGVCGKCFGKSSTLTRHLQTHSGEKPFKCP 230

  Fly   219 LCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQV 283
            .|.:.|.:...|..|.|.||||:||.|..|.|.|::...|..|.|.|.||||..|..|.|.|.|.
Human   231 ECGKGFLESATLVRHQRTHTGEKPYACGDCGRCFSESSTLLRHRRSHQGERPHACATCGKGFGQR 295

  Fly   284 GQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHTR---------GKRRT 328
            ..|.||.|.||||:||.|.:|.:.|...:.|.||...||.         |||.|
Human   296 SDLVVHQRIHTGEKPFACPECGRRFSDRSDLTKHRRTHTGEKPYRCELCGKRFT 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 20/90 (22%)
zf-C2H2 215..237 CDD:278523 6/21 (29%)
C2H2 Zn finger 217..237 CDD:275368 6/19 (32%)
zf-H2C2_2 229..254 CDD:290200 13/24 (54%)
C2H2 Zn finger 245..265 CDD:275368 7/19 (37%)
zf-H2C2_2 257..282 CDD:290200 12/24 (50%)
C2H2 Zn finger 273..293 CDD:275368 9/19 (47%)
zf-H2C2_2 286..310 CDD:290200 13/23 (57%)
C2H2 Zn finger 301..321 CDD:275368 6/19 (32%)
ZNF672NP_079112.1 COG5048 12..413 CDD:227381 93/369 (25%)
C2H2 Zn finger 16..36 CDD:275368 3/19 (16%)
C2H2 Zn finger 44..64 CDD:275368 7/19 (37%)
C2H2 Zn finger 72..89 CDD:275368 4/16 (25%)
C2H2 Zn finger 101..119 CDD:275368 4/18 (22%)
C2H2 Zn finger 165..185 CDD:275368 3/19 (16%)
C2H2 Zn finger 201..221 CDD:275368 2/19 (11%)
zf-H2C2_2 214..236 CDD:290200 3/21 (14%)
C2H2 Zn finger 229..249 CDD:275368 6/19 (32%)
zf-H2C2_2 242..265 CDD:290200 12/22 (55%)
C2H2 Zn finger 257..277 CDD:275368 7/19 (37%)
C2H2 Zn finger 285..305 CDD:275368 9/19 (47%)
zf-H2C2_2 297..321 CDD:290200 12/23 (52%)
C2H2 Zn finger 313..333 CDD:275368 6/19 (32%)
zf-H2C2_2 325..350 CDD:290200 9/25 (36%)
C2H2 Zn finger 341..361 CDD:275368 4/9 (44%)
zf-H2C2_2 353..377 CDD:290200
C2H2 Zn finger 369..389 CDD:275368
C2H2 Zn finger 397..414 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.