Sequence 1: | NP_648679.1 | Gene: | CG17359 / 39549 | FlyBaseID: | FBgn0036396 | Length: | 339 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021331488.1 | Gene: | si:dkey-262g12.10 / 798256 | ZFINID: | ZDB-GENE-161017-33 | Length: | 322 | Species: | Danio rerio |
Alignment Length: | 284 | Identity: | 83/284 - (29%) |
---|---|---|---|
Similarity: | 110/284 - (38%) | Gaps: | 97/284 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 115 SVMEAGKTP----------------ETSEPLLVE-LVQVKYMPPEPKPISSPLPDNNEHKLAQSY 162
Fly 163 SPAKTPHNKSKRRARSYSDNDSWSPDSELEHEDDDKIWNASKRGKPKRVPGPYRCKLCTQSFTQK 227
Fly 228 QNLEIHMRIHTGERPYK------------------------------------------------ 244
Fly 245 --------CSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKC 301
Fly 302 SKCQQSFKQLNGLQKHMSAHTRGK 325 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17359 | NP_648679.1 | zf-AD | 6..88 | CDD:285071 | |
zf-C2H2 | 215..237 | CDD:278523 | 12/21 (57%) | ||
C2H2 Zn finger | 217..237 | CDD:275368 | 12/19 (63%) | ||
zf-H2C2_2 | 229..254 | CDD:290200 | 15/80 (19%) | ||
C2H2 Zn finger | 245..265 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 257..282 | CDD:290200 | 13/24 (54%) | ||
C2H2 Zn finger | 273..293 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 286..310 | CDD:290200 | 13/23 (57%) | ||
C2H2 Zn finger | 301..321 | CDD:275368 | 9/19 (47%) | ||
si:dkey-262g12.10 | XP_021331488.1 | COG5048 | 82..>147 | CDD:227381 | 23/76 (30%) |
C2H2 Zn finger | 98..118 | CDD:275368 | 12/19 (63%) | ||
zf-H2C2_2 | 110..134 | CDD:316026 | 12/23 (52%) | ||
C2H2 Zn finger | 126..146 | CDD:275368 | 0/19 (0%) | ||
COG5048 | <151..300 | CDD:227381 | 41/112 (37%) | ||
C2H2 Zn finger | 154..174 | CDD:275368 | 0/19 (0%) | ||
C2H2 Zn finger | 182..202 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 210..230 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 238..258 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 266..286 | CDD:275368 | |||
C2H2 Zn finger | 294..314 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170588310 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |