DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and zgc:162948

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001076388.1 Gene:zgc:162948 / 797781 ZFINID:ZDB-GENE-070424-46 Length:288 Species:Danio rerio


Alignment Length:261 Identity:79/261 - (30%)
Similarity:111/261 - (42%) Gaps:47/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 ETSEPLLVELVQV--KYMPPEPKPISSP-LPDNNEHK-----LAQSYSPAKTPHNKSKRR----- 175
            |.||.|.:|.|..  |..|.|...:..| :.|.:|.:     :.:|....:|........     
Zfish     6 EESEDLKIEQVFTLKKEEPEELTELKPPKVEDEDEDEFDLMTIVESIRAERTAERDETTSIFTCQ 70

  Fly   176 --ARSYSDNDSWSPDSELEHEDDDKIWNASKRGKPKRVPG-------------PYRCKLCTQSFT 225
              |.|:|:...:  |:.:...:..:.:...:.||..|..|             ...||:|.:||.
Zfish    71 VCAMSFSEQSDF--DAHIADYNKKRPYTCCQCGKEFRQIGSLVTHKKFHTGEMSLTCKVCGKSFA 133

  Fly   226 QKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQVHT 290
            ...:::.|:|.||||||||||.|.::|...|...:|.|.||||:||.|..|.|.|.....|..|.
Zfish   134 SIYSVKSHLRTHTGERPYKCSHCGKAFISSGARCAHIRIHTGEKPFKCSLCGKSFTYRSALASHK 198

  Fly   291 RTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHTR---------GK--------RRTSSQETKRNKF 338
            ..||||:|||||.|.:||...:.|..|...||.         ||        .|..:..||:.|.
Zfish   199 TVHTGEKPFKCSLCGRSFTYRSALASHKIVHTGVTSFSCKVCGKSFPFNCNLERHINVHTKKKKN 263

  Fly   339 K 339
            |
Zfish   264 K 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071
zf-C2H2 215..237 CDD:278523 7/21 (33%)
C2H2 Zn finger 217..237 CDD:275368 7/19 (37%)
zf-H2C2_2 229..254 CDD:290200 14/24 (58%)
C2H2 Zn finger 245..265 CDD:275368 7/19 (37%)
zf-H2C2_2 257..282 CDD:290200 12/24 (50%)
C2H2 Zn finger 273..293 CDD:275368 6/19 (32%)
zf-H2C2_2 286..310 CDD:290200 14/23 (61%)
C2H2 Zn finger 301..321 CDD:275368 7/19 (37%)
zgc:162948NP_001076388.1 C2H2 Zn finger 69..89 CDD:275370 4/21 (19%)
COG5048 <94..257 CDD:227381 57/162 (35%)
C2H2 Zn finger 97..117 CDD:275368 4/19 (21%)
C2H2 Zn finger 125..145 CDD:275368 7/19 (37%)
zf-H2C2_2 137..160 CDD:290200 13/22 (59%)
C2H2 Zn finger 153..173 CDD:275368 7/19 (37%)
zf-H2C2_2 169..190 CDD:290200 12/20 (60%)
C2H2 Zn finger 181..201 CDD:275368 6/19 (32%)
zf-H2C2_2 193..218 CDD:290200 14/24 (58%)
C2H2 Zn finger 209..229 CDD:275368 7/19 (37%)
C2H2 Zn finger 237..257 CDD:275368 3/19 (16%)
C2H2 Zn finger 265..283 CDD:275368 79/261 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588384
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.