Sequence 1: | NP_648679.1 | Gene: | CG17359 / 39549 | FlyBaseID: | FBgn0036396 | Length: | 339 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001076388.1 | Gene: | zgc:162948 / 797781 | ZFINID: | ZDB-GENE-070424-46 | Length: | 288 | Species: | Danio rerio |
Alignment Length: | 261 | Identity: | 79/261 - (30%) |
---|---|---|---|
Similarity: | 111/261 - (42%) | Gaps: | 47/261 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 124 ETSEPLLVELVQV--KYMPPEPKPISSP-LPDNNEHK-----LAQSYSPAKTPHNKSKRR----- 175
Fly 176 --ARSYSDNDSWSPDSELEHEDDDKIWNASKRGKPKRVPG-------------PYRCKLCTQSFT 225
Fly 226 QKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQVHT 290
Fly 291 RTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHTR---------GK--------RRTSSQETKRNKF 338
Fly 339 K 339 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17359 | NP_648679.1 | zf-AD | 6..88 | CDD:285071 | |
zf-C2H2 | 215..237 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 217..237 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 229..254 | CDD:290200 | 14/24 (58%) | ||
C2H2 Zn finger | 245..265 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 257..282 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 273..293 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 286..310 | CDD:290200 | 14/23 (61%) | ||
C2H2 Zn finger | 301..321 | CDD:275368 | 7/19 (37%) | ||
zgc:162948 | NP_001076388.1 | C2H2 Zn finger | 69..89 | CDD:275370 | 4/21 (19%) |
COG5048 | <94..257 | CDD:227381 | 57/162 (35%) | ||
C2H2 Zn finger | 97..117 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 125..145 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 137..160 | CDD:290200 | 13/22 (59%) | ||
C2H2 Zn finger | 153..173 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 169..190 | CDD:290200 | 12/20 (60%) | ||
C2H2 Zn finger | 181..201 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 193..218 | CDD:290200 | 14/24 (58%) | ||
C2H2 Zn finger | 209..229 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 237..257 | CDD:275368 | 3/19 (16%) | ||
C2H2 Zn finger | 265..283 | CDD:275368 | 79/261 (30%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170588384 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |