| Sequence 1: | NP_648679.1 | Gene: | CG17359 / 39549 | FlyBaseID: | FBgn0036396 | Length: | 339 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_005168174.1 | Gene: | zgc:171673 / 797138 | ZFINID: | ZDB-GENE-071004-20 | Length: | 366 | Species: | Danio rerio |
| Alignment Length: | 211 | Identity: | 74/211 - (35%) |
|---|---|---|---|
| Similarity: | 106/211 - (50%) | Gaps: | 32/211 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 124 ETSEPLLVELVQVKYMPP-------EPKPISSPLPDNNE-HKL-AQSYSPAKTPHNKSKRRARSY 179
Fly 180 SDNDSWSPDSELEHEDDDKIWNASKRGKPKRVPGPYRCKLCTQSFTQKQNLEIHMRIHTGERPYK 244
Fly 245 CSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKCSKCQQSFK 309
Fly 310 QLNGLQKHMSAHTRGK 325 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG17359 | NP_648679.1 | zf-AD | 6..88 | CDD:285071 | |
| zf-C2H2 | 215..237 | CDD:278523 | 11/21 (52%) | ||
| C2H2 Zn finger | 217..237 | CDD:275368 | 11/19 (58%) | ||
| zf-H2C2_2 | 229..254 | CDD:290200 | 13/24 (54%) | ||
| C2H2 Zn finger | 245..265 | CDD:275368 | 10/19 (53%) | ||
| zf-H2C2_2 | 257..282 | CDD:290200 | 13/24 (54%) | ||
| C2H2 Zn finger | 273..293 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 286..310 | CDD:290200 | 10/23 (43%) | ||
| C2H2 Zn finger | 301..321 | CDD:275368 | 5/19 (26%) | ||
| zgc:171673 | XP_005168174.1 | COG5048 | 67..>360 | CDD:227381 | 58/147 (39%) |
| C2H2 Zn finger | 86..106 | CDD:275368 | 11/19 (58%) | ||
| zf-C2H2 | 112..134 | CDD:278523 | 11/21 (52%) | ||
| C2H2 Zn finger | 114..134 | CDD:275368 | 10/19 (53%) | ||
| zf-H2C2_2 | 126..150 | CDD:290200 | 12/23 (52%) | ||
| C2H2 Zn finger | 142..162 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 156..179 | CDD:290200 | 10/22 (45%) | ||
| C2H2 Zn finger | 170..190 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 198..218 | CDD:275368 | |||
| C2H2 Zn finger | 226..246 | CDD:275368 | |||
| zf-H2C2_2 | 238..263 | CDD:290200 | |||
| C2H2 Zn finger | 254..274 | CDD:275368 | |||
| zf-H2C2_2 | 266..291 | CDD:290200 | |||
| C2H2 Zn finger | 282..302 | CDD:275368 | |||
| C2H2 Zn finger | 309..329 | CDD:275368 | |||
| zf-C2H2 | 335..357 | CDD:278523 | |||
| C2H2 Zn finger | 337..357 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C170588373 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||