| Sequence 1: | NP_648679.1 | Gene: | CG17359 / 39549 | FlyBaseID: | FBgn0036396 | Length: | 339 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001107104.1 | Gene: | zgc:175107 / 794317 | ZFINID: | ZDB-GENE-080220-38 | Length: | 333 | Species: | Danio rerio |
| Alignment Length: | 205 | Identity: | 72/205 - (35%) |
|---|---|---|---|
| Similarity: | 105/205 - (51%) | Gaps: | 22/205 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 124 ETSEPLLVE-LVQVKYMPPEPK-PISSPLPDNNE-HKLAQSYSPAKTPHNKSKRRARSYSDNDSW 185
Fly 186 SPDSELEHEDDDKIWNASKRGKPKRVPGPYRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPR 250
Fly 251 SFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQ 315
Fly 316 KHMSAHTRGK 325 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG17359 | NP_648679.1 | zf-AD | 6..88 | CDD:285071 | |
| zf-C2H2 | 215..237 | CDD:278523 | 12/21 (57%) | ||
| C2H2 Zn finger | 217..237 | CDD:275368 | 11/19 (58%) | ||
| zf-H2C2_2 | 229..254 | CDD:290200 | 14/24 (58%) | ||
| C2H2 Zn finger | 245..265 | CDD:275368 | 10/19 (53%) | ||
| zf-H2C2_2 | 257..282 | CDD:290200 | 14/24 (58%) | ||
| C2H2 Zn finger | 273..293 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 286..310 | CDD:290200 | 12/23 (52%) | ||
| C2H2 Zn finger | 301..321 | CDD:275368 | 7/19 (37%) | ||
| zgc:175107 | NP_001107104.1 | C2H2 Zn finger | 83..103 | CDD:275368 | 11/19 (58%) |
| zf-H2C2_2 | 95..120 | CDD:290200 | 14/24 (58%) | ||
| COG5048 | <107..286 | CDD:227381 | 39/85 (46%) | ||
| C2H2 Zn finger | 111..131 | CDD:275368 | 10/19 (53%) | ||
| zf-H2C2_2 | 123..148 | CDD:290200 | 14/24 (58%) | ||
| C2H2 Zn finger | 139..159 | CDD:275368 | 8/19 (42%) | ||
| zf-C2H2 | 165..187 | CDD:278523 | 8/21 (38%) | ||
| C2H2 Zn finger | 167..187 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 195..215 | CDD:275368 | |||
| C2H2 Zn finger | 223..243 | CDD:275368 | |||
| C2H2 Zn finger | 251..271 | CDD:275368 | |||
| zf-H2C2_2 | 264..287 | CDD:290200 | |||
| C2H2 Zn finger | 279..299 | CDD:275368 | |||
| zf-H2C2_2 | 291..316 | CDD:290200 | |||
| C2H2 Zn finger | 307..324 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C170588362 | |
| Domainoid | 1 | 1.000 | 42 | 1.000 | Domainoid score | I12423 |
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.930 | |||||