DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and ZSCAN9

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:XP_011513177.1 Gene:ZSCAN9 / 7746 HGNCID:12984 Length:583 Species:Homo sapiens


Alignment Length:369 Identity:92/369 - (24%)
Similarity:154/369 - (41%) Gaps:90/369 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YTEPYASSNRVQEQ-------EPVLATMLRECSG-----CSVHKEDGMPQFICVECAEAVRN--- 70
            :..|:.|:   :||       |..|:.:.:|..|     |   .|.|....|.:|..|...:   
Human   212 WLRPHVST---KEQILDLLVLEQFLSILPKELQGWVREHC---PESGEEAVILLEDLERELDEPQ 270

  Fly    71 ----AYRLRRQ--CRKSHQYFEQLRLMMKE--------LDDIEYCLNIGDNIEPQMPVSVMEAGK 121
                |:|.|::  |::.....||..|.::.        .|..:.|.:||:.    .|:.:.:..:
Human   271 HEMVAHRHRQEVLCKEMVPLAEQTPLTLQSQPKEPQLTCDSAQKCHSIGET----APLWISDLIR 331

  Fly   122 ----------------TPET---SEPLLVELVQVKYMPPEPKPISSPLPDN-------------N 154
                            :.:|   |:|:::         |:.|......|:|             .
Human   332 SLRRRAVLIPLGAHLFSTDTFLFSKPVVI---------PQLKGGGETWPNNRGVLRDEVTKTEDR 387

  Fly   155 EHKLAQSYSPAKTPHNKS-KRRARSYSDNDSWSPDSELEHEDD-DKIWNASKRGKPKRVPGPYRC 217
            |..|.:.......||.|. ..:....|..|. |.....||:|. ::.| .:..|:     |.::|
Human   388 ELVLRKDCPKIVEPHGKMFNEQTWEVSQQDP-SHGEVGEHKDRIERQW-GNLLGE-----GQHKC 445

  Fly   218 KLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQ 282
            ..|.:||||...|..|.|||||||||:|:.|.::|::...|.:|...|..::.:.|..|.|.|.|
Human   446 DECGKSFTQSSGLIRHQRIHTGERPYECNECGKAFSRSSGLFNHRGIHNIQKRYHCKECGKVFSQ 510

  Fly   283 VGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHTRGKR 326
            ...|..|.|.|.||:|::||:|.:|:.:.:.|.:|..:|| |:|
Human   511 SAGLIQHQRIHKGEKPYQCSQCSKSYSRRSFLIEHQRSHT-GER 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 19/87 (22%)
zf-C2H2 215..237 CDD:278523 9/21 (43%)
C2H2 Zn finger 217..237 CDD:275368 9/19 (47%)
zf-H2C2_2 229..254 CDD:290200 14/24 (58%)
C2H2 Zn finger 245..265 CDD:275368 5/19 (26%)
zf-H2C2_2 257..282 CDD:290200 7/24 (29%)
C2H2 Zn finger 273..293 CDD:275368 8/19 (42%)
zf-H2C2_2 286..310 CDD:290200 11/23 (48%)
C2H2 Zn finger 301..321 CDD:275368 6/19 (32%)
ZSCAN9XP_011513177.1 SCAN 180..292 CDD:128708 18/85 (21%)
SCAN 181..268 CDD:280241 14/61 (23%)
COG5048 <442..578 CDD:227381 45/113 (40%)
zf-C2H2 443..465 CDD:278523 9/21 (43%)
C2H2 Zn finger 445..465 CDD:275368 9/19 (47%)
zf-H2C2_2 458..482 CDD:290200 14/23 (61%)
C2H2 Zn finger 473..493 CDD:275368 5/19 (26%)
zf-C2H2 499..521 CDD:278523 8/21 (38%)
C2H2 Zn finger 501..521 CDD:275368 8/19 (42%)
zf-H2C2_2 514..538 CDD:290200 11/23 (48%)
C2H2 Zn finger 529..549 CDD:275368 6/19 (32%)
zf-H2C2_2 542..566 CDD:290200 6/13 (46%)
C2H2 Zn finger 557..577 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.