DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and Zfp787

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001013030.1 Gene:Zfp787 / 67109 MGIID:1914359 Length:381 Species:Mus musculus


Alignment Length:168 Identity:65/168 - (38%)
Similarity:84/168 - (50%) Gaps:28/168 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 DSWSP---DSE----LEHE--------DDDKI--WNASKRGKPK-----------RVPGPYRCKL 219
            ::|||   |||    ..||        |||.:  |..:|...|:           |.|.||.|..
Mouse     6 EAWSPGPLDSEDQQMASHENPVDILIMDDDDVPSWPPTKLSPPQSAPPPGPPPRPRPPAPYICTE 70

  Fly   220 CTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVG 284
            |.:||:....|..|.|.||||||..|:.|.::|:|..:|..|.|.||||:|:.|..|.|||....
Mouse    71 CGKSFSHWSKLTRHQRTHTGERPNACTDCGKTFSQSSHLVQHRRIHTGEKPYACSECGKRFSWSS 135

  Fly   285 QLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHT 322
            .|..|.|.||||:|:.|..|.:||.|...|.||..:|:
Mouse   136 NLMQHQRIHTGEKPYTCPDCGRSFTQSKSLAKHRRSHS 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071
zf-C2H2 215..237 CDD:278523 8/21 (38%)
C2H2 Zn finger 217..237 CDD:275368 7/19 (37%)
zf-H2C2_2 229..254 CDD:290200 12/24 (50%)
C2H2 Zn finger 245..265 CDD:275368 7/19 (37%)
zf-H2C2_2 257..282 CDD:290200 13/24 (54%)
C2H2 Zn finger 273..293 CDD:275368 8/19 (42%)
zf-H2C2_2 286..310 CDD:290200 12/23 (52%)
C2H2 Zn finger 301..321 CDD:275368 8/19 (42%)
Zfp787NP_001013030.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..65 16/58 (28%)
zf-C2H2 66..88 CDD:395048 8/21 (38%)
C2H2 Zn finger 68..88 CDD:275368 7/19 (37%)
COG5048 <93..200 CDD:227381 35/81 (43%)
C2H2 Zn finger 96..116 CDD:275368 7/19 (37%)
C2H2 Zn finger 124..144 CDD:275368 8/19 (42%)
C2H2 Zn finger 152..172 CDD:275368 8/19 (42%)
C2H2 Zn finger 180..200 CDD:275368
C2H2 Zn finger 282..302 CDD:275368
C2H2 Zn finger 319..339 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.