DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and ZSCAN31

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001128687.1 Gene:ZSCAN31 / 64288 HGNCID:14097 Length:406 Species:Homo sapiens


Alignment Length:425 Identity:108/425 - (25%)
Similarity:165/425 - (38%) Gaps:136/425 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RVCRDESDCLLDIYTEPYASSNRVQEQEPVLATMLRECSGCSVHKEDGMPQFICVECAEAVRNAY 72
            ::.:.|.|.:.|  .|.:...|....||.......:.|     ::|...|:       ||:.   
Human    11 KIVKVEEDPIWD--QETHLRGNNFSGQEASRQLFRQFC-----YQETPGPR-------EALS--- 58

  Fly    73 RLRRQCRKSHQYF------------------------EQLRLMMKE------------LDDIEYC 101
            |||..|   ||:.                        |:|:..::|            ::|:|..
Human    59 RLRELC---HQWLRPEIHTKEQILELLVLEQFLTILPEELQAWVREHHPESGEEAVAVVEDLEQE 120

  Fly   102 LNIGDNIEPQMPVSVMEAGKTPETSEPLL--VELVQVKYMPP--EPKPISSPL------------ 150
            |:     ||.......|.|.    ||.||  ||.::||..|.  :.:|:.:.|            
Human   121 LS-----EPGNQAPDHEHGH----SEVLLEDVEHLKVKQEPTDIQLQPMVTQLRYESFCLHQFQE 176

  Fly   151 ------PDNNE----------------HKLAQ---------------SYSPAKTPHNKSKRRARS 178
                  |:|.|                .||.:               |.:..:..|:..:||.|.
Human   177 QDGESIPENQELASKQEILKEMEHLGDSKLQRDVSLDSKYRETCKRDSKAEKQQAHSTGERRHRC 241

  Fly   179 YSDNDSWSPDSEL-EHE---DDDKIWNASKRGKP-----------KRVPG--PYRCKLCTQSFTQ 226
            .....|::..|.| ||:   ..:|.:...:.||.           :...|  ||:||.|.::|:.
Human   242 NECGKSFTKSSVLIEHQRIHTGEKPYECEECGKAFSRRSSLNEHRRSHTGEKPYQCKECGKAFSA 306

  Fly   227 KQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQVHTR 291
            ...|..|.||||||:||:|.:|.::|.....|..|.|.||||:.:.|..|.|.|.|...|..|.|
Human   307 SNGLTRHRRIHTGEKPYECKVCGKAFLLSSCLVQHQRIHTGEKRYQCRECGKAFIQNAGLFQHLR 371

  Fly   292 THTGEQPFKCSKCQQSFKQLNGLQKHMSAHTRGKR 326
            .||||:|::||:|.:.|.:...|:||...|| |:|
Human   372 VHTGEKPYQCSQCSKLFSKRTLLKKHQKIHT-GER 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 19/103 (18%)
zf-C2H2 215..237 CDD:278523 8/21 (38%)
C2H2 Zn finger 217..237 CDD:275368 7/19 (37%)
zf-H2C2_2 229..254 CDD:290200 13/24 (54%)
C2H2 Zn finger 245..265 CDD:275368 6/19 (32%)
zf-H2C2_2 257..282 CDD:290200 11/24 (46%)
C2H2 Zn finger 273..293 CDD:275368 8/19 (42%)
zf-H2C2_2 286..310 CDD:290200 12/23 (52%)
C2H2 Zn finger 301..321 CDD:275368 7/19 (37%)
ZSCAN31NP_001128687.1 SCAN 35..146 CDD:128708 29/137 (21%)
SCAN 35..123 CDD:280241 19/110 (17%)
COG5048 <156..397 CDD:227381 65/240 (27%)
zf-C2H2 239..261 CDD:278523 6/21 (29%)
C2H2 Zn finger 241..261 CDD:275368 5/19 (26%)
zf-H2C2_2 254..278 CDD:290200 6/23 (26%)
C2H2 Zn finger 269..289 CDD:275368 2/19 (11%)
zf-H2C2_2 281..305 CDD:290200 6/23 (26%)
C2H2 Zn finger 297..317 CDD:275368 7/19 (37%)
zf-H2C2_2 310..332 CDD:290200 12/21 (57%)
C2H2 Zn finger 325..345 CDD:275368 6/19 (32%)
zf-H2C2_2 338..362 CDD:290200 11/23 (48%)
C2H2 Zn finger 353..373 CDD:275368 8/19 (42%)
zf-H2C2_2 366..389 CDD:290200 11/22 (50%)
C2H2 Zn finger 381..401 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.