| Sequence 1: | NP_648679.1 | Gene: | CG17359 / 39549 | FlyBaseID: | FBgn0036396 | Length: | 339 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_009299290.1 | Gene: | zgc:171604 / 569282 | ZFINID: | ZDB-GENE-080219-37 | Length: | 339 | Species: | Danio rerio |
| Alignment Length: | 217 | Identity: | 72/217 - (33%) |
|---|---|---|---|
| Similarity: | 103/217 - (47%) | Gaps: | 18/217 - (8%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 122 TPETSEPLLVELVQVKYMPPEPKP----ISSPLPDNNE---------HKLAQSYSPAKTPHNKSK 173
Fly 174 RRARSYSDNDSWSPDSELEHEDDDKIWNASKRGKPKRVPGPYRCKLCTQSFTQKQNLEIHMRIHT 238
Fly 239 GERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKCSK 303
Fly 304 CQQSFKQLNGLQKHMSAHTRGK 325 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG17359 | NP_648679.1 | zf-AD | 6..88 | CDD:285071 | |
| zf-C2H2 | 215..237 | CDD:278523 | 11/21 (52%) | ||
| C2H2 Zn finger | 217..237 | CDD:275368 | 11/19 (58%) | ||
| zf-H2C2_2 | 229..254 | CDD:290200 | 14/24 (58%) | ||
| C2H2 Zn finger | 245..265 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 257..282 | CDD:290200 | 14/24 (58%) | ||
| C2H2 Zn finger | 273..293 | CDD:275368 | 11/19 (58%) | ||
| zf-H2C2_2 | 286..310 | CDD:290200 | 12/23 (52%) | ||
| C2H2 Zn finger | 301..321 | CDD:275368 | 6/19 (32%) | ||
| zgc:171604 | XP_009299290.1 | COG5048 | <79..234 | CDD:227381 | 59/152 (39%) |
| C2H2 Zn finger | 89..109 | CDD:275368 | 2/19 (11%) | ||
| C2H2 Zn finger | 117..137 | CDD:275368 | 11/19 (58%) | ||
| C2H2 Zn finger | 145..165 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 173..193 | CDD:275368 | 11/19 (58%) | ||
| C2H2 Zn finger | 201..221 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 229..249 | CDD:275368 | |||
| zf-H2C2_2 | 241..266 | CDD:316026 | |||
| C2H2 Zn finger | 257..277 | CDD:275368 | |||
| C2H2 Zn finger | 285..305 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C170588381 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||