DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and si:ch211-79k12.2

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001313520.1 Gene:si:ch211-79k12.2 / 568844 ZFINID:ZDB-GENE-131121-535 Length:555 Species:Danio rerio


Alignment Length:104 Identity:53/104 - (50%)
Similarity:68/104 - (65%) Gaps:0/104 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 PYRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPK 278
            ||.|..|.:||:|...|:||.|||||||||.||.|.|.|.....:::|.|.||||:|:.|..|.|
Zfish   336 PYICTNCGKSFSQSGALKIHRRIHTGERPYTCSYCGRGFPHLAGVRAHQRIHTGEKPYICGQCGK 400

  Fly   279 RFRQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKH 317
            .|.|.|.|::|||.||||:||.|..|.:||...:|::.|
Zfish   401 CFTQSGALKIHTRIHTGERPFVCGLCGKSFSNRSGIRFH 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071
zf-C2H2 215..237 CDD:278523 10/21 (48%)
C2H2 Zn finger 217..237 CDD:275368 9/19 (47%)
zf-H2C2_2 229..254 CDD:290200 17/24 (71%)
C2H2 Zn finger 245..265 CDD:275368 7/19 (37%)
zf-H2C2_2 257..282 CDD:290200 11/24 (46%)
C2H2 Zn finger 273..293 CDD:275368 10/19 (53%)
zf-H2C2_2 286..310 CDD:290200 14/23 (61%)
C2H2 Zn finger 301..321 CDD:275368 6/17 (35%)
si:ch211-79k12.2NP_001313520.1 C2H2 Zn finger 281..302 CDD:275368
C2H2 Zn finger 311..331 CDD:275368
zf-H2C2_2 323..348 CDD:290200 6/11 (55%)
C2H2 Zn finger 339..359 CDD:275368 9/19 (47%)
zf-H2C2_2 351..374 CDD:290200 16/22 (73%)
C2H2 Zn finger 367..387 CDD:275368 7/19 (37%)
zf-H2C2_2 380..404 CDD:290200 11/23 (48%)
C2H2 Zn finger 395..415 CDD:275368 10/19 (53%)
zf-H2C2_2 407..432 CDD:290200 14/24 (58%)
C2H2 Zn finger 423..442 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588311
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.