DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and znf576.2

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:XP_017206844.1 Gene:znf576.2 / 563587 ZFINID:ZDB-GENE-030131-1738 Length:2676 Species:Danio rerio


Alignment Length:332 Identity:84/332 - (25%)
Similarity:125/332 - (37%) Gaps:81/332 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CRVCRDESDCLLDIYTEPYASSNRVQEQEPVLATMLREC----SGCSVHKEDGMP--QFICVECA 65
            |.|| |.:....:..|:..::.|:  |.:|......:||    |..:.|:....|  ||:|.||.
Zfish  2379 CYVC-DRTFPSSEELTQHQSTHNK--EDKPFKCVHCQECFRTFSELTTHRRQVCPERQFVCKECN 2440

  Fly    66 EAVRNAYRLRRQCRKSHQYFEQLRLMM----KELDDIE------YCLNIGDNIEPQMPV------ 114
            |..|:...||     ||      |||.    ::.:|:|      .|...|...|.:..:      
Zfish  2441 ETFRSPGLLR-----SH------RLMQHPVPQDEEDVEDPSKTYRCGKCGRGFEEEAELLQHQEN 2494

  Fly   115 -----------SVMEAGKTPETSEPLLVELVQVKY--MPPEPKPISSPLPDNNEHKLAQSYSPAK 166
                       :|...|:.|             ||  ..|..|.:.....|.:..:...|...:.
Zfish  2495 HAGDRHCNGGAAVKRRGRPP-------------KYEAAAPSEKKVKKKKKDEDAEETNHSEDASA 2546

  Fly   167 TPHNKSKRRARSYSDNDSWSPDSELEH-EDDDKIWNASKRGKPKRVPGPYR---CKLCTQSFTQK 227
            |......||.|......  .|::|.|. |:|||          |.||.|.|   |..|..:|...
Zfish  2547 TSAKTGGRRGRPAKSTQ--EPEAEDEKAENDDK----------KSVPEPERQIPCTECDLTFPTL 2599

  Fly   228 QNLEIHMR-IHTGERPYKCSLCPRSFAQKGNLQSH-TRCHTGERPFGCPNCPKRFRQVGQLQVHT 290
            ..|.:|.: .||.::|:.|..|..||.:...||:| .|.|:..| ..||.|.|.|.:...|:.|.
Zfish  2600 TLLRMHKKEKHTQKKPHPCKECEESFNRPAQLQAHMARAHSVGR-HTCPTCGKSFGRESNLKAHQ 2663

  Fly   291 RTHTGEQ 297
            ::|..|:
Zfish  2664 QSHEKEE 2670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 24/86 (28%)
zf-C2H2 215..237 CDD:278523 6/25 (24%)
C2H2 Zn finger 217..237 CDD:275368 5/20 (25%)
zf-H2C2_2 229..254 CDD:290200 9/25 (36%)
C2H2 Zn finger 245..265 CDD:275368 8/20 (40%)
zf-H2C2_2 257..282 CDD:290200 11/25 (44%)
C2H2 Zn finger 273..293 CDD:275368 7/19 (37%)
zf-H2C2_2 286..310 CDD:290200 4/12 (33%)
C2H2 Zn finger 301..321 CDD:275368
znf576.2XP_017206844.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.