| Sequence 1: | NP_648679.1 | Gene: | CG17359 / 39549 | FlyBaseID: | FBgn0036396 | Length: | 339 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_009301868.1 | Gene: | LOC557537 / 557537 | -ID: | - | Length: | 393 | Species: | Danio rerio |
| Alignment Length: | 215 | Identity: | 72/215 - (33%) |
|---|---|---|---|
| Similarity: | 110/215 - (51%) | Gaps: | 25/215 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 124 ETSEPLLVELVQVKYMPPEPKPISSPLPDNNEHKLAQSYSPAKTPHNKSKRRARSYSDNDSWSPD 188
Fly 189 SELEHEDDDKIWNASKRGKPKRV-------------PGPYRCKLCTQSFTQKQNLEIHMRIHTGE 240
Fly 241 RPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKCSKCQ 305
Fly 306 QSFKQLNGLQKHMSAHTRGK 325 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG17359 | NP_648679.1 | zf-AD | 6..88 | CDD:285071 | |
| zf-C2H2 | 215..237 | CDD:278523 | 9/21 (43%) | ||
| C2H2 Zn finger | 217..237 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 229..254 | CDD:290200 | 12/24 (50%) | ||
| C2H2 Zn finger | 245..265 | CDD:275368 | 10/19 (53%) | ||
| zf-H2C2_2 | 257..282 | CDD:290200 | 13/24 (54%) | ||
| C2H2 Zn finger | 273..293 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 286..310 | CDD:290200 | 13/23 (57%) | ||
| C2H2 Zn finger | 301..321 | CDD:275368 | 7/19 (37%) | ||
| LOC557537 | XP_009301868.1 | COG5048 | 62..>379 | CDD:227381 | 62/163 (38%) |
| C2H2 Zn finger | 88..108 | CDD:275368 | 3/19 (16%) | ||
| zf-H2C2_2 | 101..125 | CDD:290200 | 6/23 (26%) | ||
| C2H2 Zn finger | 116..136 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 130..153 | CDD:290200 | 12/22 (55%) | ||
| C2H2 Zn finger | 144..164 | CDD:275368 | 10/19 (53%) | ||
| zf-H2C2_2 | 156..181 | CDD:290200 | 13/24 (54%) | ||
| C2H2 Zn finger | 172..192 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 185..209 | CDD:290200 | 13/23 (57%) | ||
| C2H2 Zn finger | 200..220 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 228..248 | CDD:275368 | |||
| C2H2 Zn finger | 256..276 | CDD:275368 | |||
| FYDLN_acid | 280..>319 | CDD:302856 | |||
| C2H2 Zn finger | 284..304 | CDD:275368 | |||
| zf-C2H2 | 310..332 | CDD:278523 | |||
| C2H2 Zn finger | 312..332 | CDD:275368 | |||
| C2H2 Zn finger | 340..360 | CDD:275368 | |||
| zf-H2C2_2 | 352..377 | CDD:290200 | |||
| C2H2 Zn finger | 368..387 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C170588300 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||