Sequence 1: | NP_648679.1 | Gene: | CG17359 / 39549 | FlyBaseID: | FBgn0036396 | Length: | 339 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021331485.1 | Gene: | si:dkey-262g12.9 / 555910 | ZFINID: | ZDB-GENE-161017-28 | Length: | 380 | Species: | Danio rerio |
Alignment Length: | 239 | Identity: | 81/239 - (33%) |
---|---|---|---|
Similarity: | 126/239 - (52%) | Gaps: | 29/239 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 88 LRLMMKELDD--IEYCLNIGDNIEPQMPVSVM--EAGKTPETSEPLLVELVQVKYMPPEPKPISS 148
Fly 149 PLPDNNEHKLAQSYSPAKTPHNKSKRRARSYSD-NDSWSPDSELEHEDDDKIWNASKRGKPKRVP 212
Fly 213 GPYRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCP 277
Fly 278 KRFRQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAH 321 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17359 | NP_648679.1 | zf-AD | 6..88 | CDD:285071 | 81/239 (34%) |
zf-C2H2 | 215..237 | CDD:278523 | 9/21 (43%) | ||
C2H2 Zn finger | 217..237 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 229..254 | CDD:290200 | 14/24 (58%) | ||
C2H2 Zn finger | 245..265 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 257..282 | CDD:290200 | 14/24 (58%) | ||
C2H2 Zn finger | 273..293 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 286..310 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 301..321 | CDD:275368 | 8/19 (42%) | ||
si:dkey-262g12.9 | XP_021331485.1 | COG5048 | <75..263 | CDD:227381 | 59/145 (41%) |
C2H2 Zn finger | 83..103 | CDD:275368 | 2/19 (11%) | ||
C2H2 Zn finger | 111..131 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 139..159 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 167..187 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 195..215 | CDD:275368 | 8/19 (42%) | ||
COG5048 | 216..>328 | CDD:227381 | 81/239 (34%) | ||
C2H2 Zn finger | 223..243 | CDD:275368 | |||
C2H2 Zn finger | 251..271 | CDD:275368 | |||
C2H2 Zn finger | 279..299 | CDD:275368 | |||
C2H2 Zn finger | 307..327 | CDD:275368 | |||
C2H2 Zn finger | 335..355 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170588301 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |