DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG17359 and zgc:113030

DIOPT Version :9

Sequence 1:	NP_648679.1	Gene:	CG17359 / 39549	FlyBaseID:	FBgn0036396	Length:	339	Species:	Drosophila melanogaster
Sequence 2:	NP_001018545.1	Gene:	zgc:113030 / 553738	ZFINID:	ZDB-GENE-050522-528	Length:	240	Species:	Danio rerio

Alignment Length:	109	Identity:	50/109 - (45%)
Similarity:	67/109 - (61%)	Gaps:	0/109 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   214 PYRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPK 278
            |:.|..|.:||||..:|..||.|||||||:.|:.|.:||.:..||..|...||||:||.|..|.:
Zfish    45 PFTCTQCGKSFTQSSSLNKHMMIHTGERPFICTQCGKSFTRSSNLIEHMLIHTGEKPFTCTQCGR 109

  Fly   279 RFRQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHT 322
            .|||...|..|...||||:|.:|.:|.|:|.:.:.|:.|:..||
Zfish   110 NFRQAAHLNQHIVIHTGEKPHRCDQCGQTFARRSFLKFHLRVHT 153

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG17359	NP_648679.1	zf-AD	6..88	CDD:285071
		zf-C2H2	215..237	CDD:278523	9/21 (43%)
		C2H2 Zn finger	217..237	CDD:275368	9/19 (47%)
		zf-H2C2_2	229..254	CDD:290200	14/24 (58%)
		C2H2 Zn finger	245..265	CDD:275368	7/19 (37%)
		zf-H2C2_2	257..282	CDD:290200	12/24 (50%)
		C2H2 Zn finger	273..293	CDD:275368	7/19 (37%)
		zf-H2C2_2	286..310	CDD:290200	11/23 (48%)
		C2H2 Zn finger	301..321	CDD:275368	6/19 (32%)
zgc:113030	NP_001018545.1	C2H2 Zn finger	20..40	CDD:275368
		COG5048	<25..204	CDD:227381	50/109 (46%)
		zf-H2C2_2	32..57	CDD:290200	5/11 (45%)
		C2H2 Zn finger	48..68	CDD:275368	9/19 (47%)
		zf-H2C2_2	60..85	CDD:290200	14/24 (58%)
		C2H2 Zn finger	76..96	CDD:275368	7/19 (37%)
		C2H2 Zn finger	104..124	CDD:275368	7/19 (37%)
		zf-H2C2_2	116..141	CDD:290200	11/24 (46%)
		C2H2 Zn finger	132..152	CDD:275368	6/19 (32%)
		C2H2 Zn finger	160..180	CDD:275368
		C2H2 Zn finger	188..208	CDD:275368
		zf-H2C2_2	200..225	CDD:290200
		C2H2 Zn finger	216..236	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	0	0.000