| Sequence 1: | NP_648679.1 | Gene: | CG17359 / 39549 | FlyBaseID: | FBgn0036396 | Length: | 339 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001034204.1 | Gene: | Zkscan4 / 544922 | MGIID: | 3649412 | Length: | 480 | Species: | Mus musculus |
| Alignment Length: | 327 | Identity: | 85/327 - (25%) |
|---|---|---|---|
| Similarity: | 133/327 - (40%) | Gaps: | 88/327 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 73 RLRRQCRK-----SHQYFEQLRLMMKELDDIEYCLNIGDNIEPQMPVSVMEAGKTPETSEPL--L 130
Fly 131 VELV--QVKYMPPEPK-------------PISSPLPDNN-----------EHKLAQSY--SPAKT 167
Fly 168 ------PHNKSKRRARSYSDNDSWS------------PDSELEHEDDDKIWNASKRG-------- 206
Fly 207 --------------KPKRV---PGPYRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQ 254
Fly 255 KGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMS 319
Fly 320 AH 321 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG17359 | NP_648679.1 | zf-AD | 6..88 | CDD:285071 | 6/19 (32%) |
| zf-C2H2 | 215..237 | CDD:278523 | 8/21 (38%) | ||
| C2H2 Zn finger | 217..237 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 229..254 | CDD:290200 | 13/24 (54%) | ||
| C2H2 Zn finger | 245..265 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 257..282 | CDD:290200 | 13/24 (54%) | ||
| C2H2 Zn finger | 273..293 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 286..310 | CDD:290200 | 11/23 (48%) | ||
| C2H2 Zn finger | 301..321 | CDD:275368 | 5/19 (26%) | ||
| Zkscan4 | NP_001034204.1 | SCAN | 47..155 | CDD:128708 | 20/93 (22%) |
| SCAN | 47..135 | CDD:280241 | 18/73 (25%) | ||
| zf-C2H2 | 253..275 | CDD:278523 | 3/21 (14%) | ||
| C2H2 Zn finger | 255..275 | CDD:275368 | 3/19 (16%) | ||
| zf-H2C2_2 | 268..290 | CDD:290200 | 7/21 (33%) | ||
| C2H2 Zn finger | 283..303 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 295..320 | CDD:290200 | 13/24 (54%) | ||
| COG5048 | <307..471 | CDD:227381 | 33/81 (41%) | ||
| zf-C2H2 | 309..331 | CDD:278523 | 8/21 (38%) | ||
| C2H2 Zn finger | 311..331 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 323..348 | CDD:290200 | 13/24 (54%) | ||
| C2H2 Zn finger | 339..359 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 351..376 | CDD:290200 | 11/24 (46%) | ||
| zf-C2H2 | 365..387 | CDD:278523 | 6/21 (29%) | ||
| C2H2 Zn finger | 367..387 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 422..442 | CDD:275368 | |||
| zf-H2C2_2 | 434..459 | CDD:290200 | |||
| C2H2 Zn finger | 450..470 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||